Estrogen Related Receptor gamma (ESRRG) (NM_001438) Human Tagged ORF Clone

CAT#: RC218233

Reviews ()
Write a review

ESRRG (Myc-DDK-tagged)-Human estrogen-related receptor gamma (ESRRG), transcript variant 1



  "NM_001438" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 457.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "ESRRG"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ESRRG
Synonyms ERR-gamma; ERR3; ERRg; ERRgamma; NR3B3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC218233 representing NM_001438
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATTCGGTAGAACTTTGCCTTCCTGAATCTTTTTCCCTGCACTACGAGGAAGAGCTTCCCTGCAGAA
TGTCAAACAAAGATCGACACATTGATTCCAGCTGTTCGTCCTTCATCAAGACGGAACCTTCCAGCCCAGC
CTCCCTGACGGACAGCGTCAACCACCACAGCCCTGGTGGCTCTTCAGACGCCAGTGGGAGCTACAGTTCA
ACCATGAATGGCCATCAGAACGGACTTGACTCGCCACCTCTCTACCCTTCTGCTCCTATCCTGGGAGGTA
GTGGGCCTGTCAGGAAACTGTATGATGACTGCTCCAGCACCATTGTTGAAGATCCCCAGACCAAGTGTGA
ATACATGCTCAACTCGATGCCCAAGAGACTGTGTTTAGTGTGTGGTGACATCGCTTCTGGGTACCACTAT
GGGGTAGCATCATGTGAAGCCTGCAAGGCATTCTTCAAGAGGACAATTCAAGGCAATATAGAATACAGCT
GCCCTGCCACGAATGAATGTGAAATCACAAAGCGCAGACGTAAATCCTGCCAGGCTTGCCGCTTCATGAA
GTGTTTAAAAGTGGGCATGCTGAAAGAAGGGGTGCGTCTTGACAGAGTACGTGGAGGTCGGCAGAAGTAC
AAGCGCAGGATAGATGCGGAGAACAGCCCATACCTGAACCCTCAGCTGGTTCAGCCAGCCAAAAAGCCAT
ATAACAAGATTGTCTCACATTTGTTGGTGGCTGAACCGGAGAAGATCTATGCCATGCCTGACCCTACTGT
CCCCGACAGTGACATCAAAGCCCTCACTACACTGTGTGACTTGGCCGACCGAGAGTTGGTGGTTATCATT
GGATGGGCGAAGCATATTCCAGGCTTCTCCACGCTGTCCCTGGCGGACCAGATGAGCCTTCTGCAGAGTG
CTTGGATGGAAATTTTGATCCTTGGTGTCGTATACCGGTCTCTTTCATTTGAGGATGAACTTGTCTATGC
AGACGATTATATAATGGACGAAGACCAGTCCAAATTAGCAGGCCTTCTTGATCTAAATAATGCTATCCTG
CAGCTGGTAAAGAAATACAAGAGCATGAAGCTGGAAAAAGAAGAATTTGTCACCCTCAAAGCTATAGCTC
TTGCTAATTCAGACTCCATGCACATAGAAGATGTTGAAGCCGTTCAGAAGCTTCAGGATGTCTTACATGA
AGCGCTGCAGGATTATGAAGCTGGCCAGCACATGGAAGACCCTCGTCGAGCTGGCAAGATGCTGATGACA
CTGCCACTCCTGAGGCAGACCTCTACCAAGGCCGTGCAGCATTTCTACAACATCAAACTAGAAGGCAAAG
TCCCAATGCACAAACTTTTTTTGGAAATGTTGGAGGCCAAGGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC218233 representing NM_001438
Red=Cloning site Green=Tags(s)

MDSVELCLPESFSLHYEEELPCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSS
TMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHY
GVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKY
KRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVII
GWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAIL
QLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMT
LPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001438
ORF Size 1374 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001438.4
RefSeq Size 5253 bp
RefSeq ORF 1377 bp
Locus ID 2104
UniProt ID P62508
Cytogenetics 1q41
Domains HOLI, zf-C4
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
MW 51.1 kDa
Gene Summary This gene encodes a member of the estrogen receptor-related receptor (ESRR) family, which belongs to the nuclear hormone receptor superfamily. All members of the ESRR family share an almost identical DNA binding domain, which is composed of two C4-type zinc finger motifs. The ESRR members are orphan nuclear receptors; they bind to the estrogen response element and steroidogenic factor 1 response element, and activate genes controlled by both response elements in the absence of any ligands. The ESRR family is closely related to the estrogen receptor (ER) family. They share target genes, co-regulators and promoters, and by targeting the same set of genes, the ESRRs seem to interfere with the ER-mediated estrogen response in various ways. It has been reported that the family member encoded by this gene functions as a transcriptional activator of DNA cytosine-5-methyltransferases 1 (Dnmt1) expression by direct binding to its response elements in the DNMT1 promoters, modulates cell proliferation and estrogen signaling in breast cancer, and negatively regulates bone morphogenetic protein 2-induced osteoblast differentiation and bone formation. Multiple alternatively spliced transcript variants have been identified, which mainly differ at the 5' end and some of which encode protein isoforms differing in the N-terminal region. [provided by RefSeq, Aug 2011]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.