CAMK2A (NM_015981) Human Tagged ORF Clone

CAT#: RC218186

CAMK2A (Myc-DDK-tagged)-Human calcium/calmodulin-dependent protein kinase II alpha (CAMK2A), transcript variant 1

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name CAMK2A (NM_015981) Human Tagged ORF Clone
Symbol CAMK2A
Synonyms CAMKA; CAMKA
Vector pCMV6-Entry
Sequence Data
>RC218186 representing NM_015981
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCACCATCACCTGCACCCGCTTCACGGAAGAGTACCAGCTCTTCGAGGAATTGGGCAAGGGAGCCT
TCTCGGTGGTGCGAAGGTGTGTGAAGGTGCTGGCTGGCCAGGAGTATGCTGCCAAGATCATCAACACAAA
GAAGCTGTCAGCCAGAGACCATCAGAAGCTGGAGCGTGAAGCCCGCATCTGCCGCCTGCTGAAGCACCCC
AACATCGTCCGACTACATGACAGCATCTCAGAGGAGGGACACCACTACCTGATCTTCGACCTGGTCACTG
GTGGGGAACTGTTTGAAGATATCGTGGCCCGGGAGTATTACAGTGAGGCGGATGCCAGTCACTGTATCCA
GCAGATCCTGGAGGCTGTGCTGCACTGCCACCAGATGGGGGTGGTGCACCGGGACCTGAAGCCTGAGAAT
CTGTTGCTGGCCTCCAAGCTCAAGGGTGCCGCAGTGAAGCTGGCAGACTTTGGCCTGGCCATAGAGGTGG
AGGGGGAGCAGCAGGCATGGTTTGGGTTTGCAGGGACTCCTGGATATCTCTCCCCAGAAGTGCTGCGGAA
GGACCCGTACGGGAAGCCTGTGGACCTGTGGGCTTGTGGGGTCATCCTGTACATCCTGCTGGTTGGGTAC
CCCCCGTTCTGGGATGAGGACCAGCACCGCCTGTACCAGCAGATCAAAGCCGGCGCCTATGATTTCCCAT
CGCCGGAATGGGACACTGTCACCCCGGAAGCCAAGGATCTGATCAATAAGATGCTGACCATTAACCCATC
CAAACGCATCACAGCTGCCGAAGCCCTTAAGCACCCCTGGATCTCGCACCGCTCCACCGTGGCATCCTGC
ATGCACAGACAGGAGACCGTGGACTGCCTGAAGAAGTTCAATGCCAGGAGGAAACTGAAGGGAGCCATTC
TCACCACGATGCTGGCCACCAGGAACTTCTCCGGAGGGAAGAGTGGGGGAAACAAGAAGAGCGATGGTGT
GAAGAAAAGAAAGTCCAGTTCCAGCGTTCAGTTAATGGAATCCTCAGAGAGCACCAACACCACCATCGAG
GATGAAGACACCAAAGTGCGGAAACAGGAAATTATAAAAGTGACAGAGCAGCTGATTGAAGCCATAAGCA
ATGGAGATTTTGAGTCCTACACGAAGATGTGCGACCCTGGCATGACAGCCTTCGAACCTGAGGCCCTGGG
GAACCTGGTTGAGGGCCTGGACTTCCATCGATTCTATTTTGAAAACCTGTGGTCCCGGAACAGCAAGCCC
GTGCACACCACCATCCTGAATCCCCACATCCACCTGATGGGCGACGAGTCAGCCTGCATCGCCTACATCC
GCATCACGCAGTACCTGGACGCTGGCGGCATCCCACGCACCGCCCAGTCGGAGGAGACCCGTGTCTGGCA
CCGCCGGGATGGCAAATGGCAGATCGTCCACTTCCACAGATCTGGGGCGCCCTCCGTCCTGCCCCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC218186 representing NM_015981
Red=Cloning site Green=Tags(s)

MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLEREARICRLLKHP
NIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPEN
LLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDLWACGVILYILLVGY
PPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASC
MHRQETVDCLKKFNARRKLKGAILTTMLATRNFSGGKSGGNKKSDGVKKRKSSSSVQLMESSESTNTTIE
DEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP
VHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_015981
ORF Size 1467 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_015981.1, NM_015981.2, NM_015981.3, NP_057065
RefSeq Size 4836
RefSeq ORF 1470
Locus ID 815
Cytogenetics 5q32
Domains pkinase, TyrKc, S_TKc
Protein Families Protein Kinase, Druggable Genome
Protein Pathways ErbB signaling pathway, Calcium signaling pathway, Oocyte meiosis, Wnt signaling pathway, Long-term potentiation, Neurotrophin signaling pathway, Olfactory transduction, GnRH signaling pathway, Melanogenesis, Glioma
MW 55.1 kDa
Gene Summary The product of this gene belongs to the serine/threonine protein kinases family, and to the Ca(2+)/calmodulin-dependent protein kinases subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. This calcium calmodulin-dependent protein kinase is composed of four different chains: alpha, beta, gamma, and delta. The alpha chain encoded by this gene is required for hippocampal long-term potentiation (LTP) and spatial learning. In addition to its calcium-calmodulin (CaM)-dependent activity, this protein can undergo autophosphorylation, resulting in CaM-independent activity. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Nov 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)