MRP1 (ABCC1) (NM_004996) Human Tagged ORF Clone

CAT#: RC218182

Reviews ()
Write a review

ABCC1 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1



  "NM_004996" in other vectors (6)

USD 1,270.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name MRP1 (ABCC1) (NM_004996) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ABCC1
Synonyms ABC29; ABCC; GS-X; MRP; MRP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC218182 representing NM_004996
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTCACGTGGAATA
CCAGCAACCCCGACTTCACCAAGTGCTTTCAGAACACGGTCCTCGTGTGGGTGCCTTGTTTTTACCTCTG
GGCCTGTTTCCCCTTCTACTTCCTCTATCTCTCCCGACATGACCGAGGCTACATTCAGATGACACCTCTC
AACAAAACCAAAACTGCCTTGGGATTTTTGCTGTGGATCGTCTGCTGGGCAGACCTCTTCTACTCTTTCT
GGGAAAGAAGTCGGGGCATATTCCTGGCCCCAGTGTTTCTGGTCAGCCCAACTCTCTTGGGCATCACCAT
GCTGCTTGCTACCTTTTTAATTCAGCTGGAGAGGAGGAAGGGAGTTCAGTCTTCAGGGATCATGCTCACT
TTCTGGCTGGTAGCCCTAGTGTGTGCCCTAGCCATCCTGAGATCCAAAATTATGACAGCCTTAAAAGAGG
ATGCCCAGGTGGACCTGTTTCGTGACATCACTTTCTACGTCTACTTTTCCCTCTTACTCATTCAGCTCGT
CTTGTCCTGTTTCTCAGATCGCTCACCCCTGTTCTCGGAAACCATCCACGACCCTAATCCCTGCCCAGAG
TCCAGCGCTTCCTTCCTGTCGAGGATCACCTTCTGGTGGATCACAGGGTTGATTGTCCGGGGCTACCGCC
AGCCCCTGGAGGGCAGTGACCTCTGGTCCTTAAACAAGGAGGACACGTCGGAACAAGTCGTGCCTGTTTT
GGTAAAGAACTGGAAGAAGGAATGCGCCAAGACTAGGAAGCAGCCGGTGAAGGTCGTGTACTCCTCCAAG
GATCCTGCCCAGCCGAAAGAGAGTTCCAAGGTGGATGCGAATGAGGAGGTGGAGGCTTTGATCGTCAAGT
CCCCACAGAAGGAGTGGAACCCCTCTCTGTTTAAGGTGTTATACAAGACCTTTGGGCCCTACTTCCTCAT
GAGCTTCTTCTTCAAGGCCATCCACGACCTGATGATGTTTTCCGGGCCGCAGATCTTAAAGTTGCTCATC
AAGTTCGTGAACGACACGAAGGCCCCAGACTGGCAGGGCTACTTCTACACCGTGCTGCTGTTTGTCACTG
CCTGCCTGCAGACCCTCGTGCTGCACCAGTACTTCCACATCTGCTTCGTCAGTGGCATGAGGATCAAGAC
CGCTGTCATTGGGGCTGTCTATCGGAAGGCCCTGGTGATCACCAATTCAGCCAGAAAATCCTCCACGGTC
GGGGAGATTGTCAACCTCATGTCTGTGGACGCTCAGAGGTTCATGGACTTGGCCACGTACATTAACATGA
TCTGGTCAGCCCCCCTGCAAGTCATCCTTGCTCTCTACCTCCTGTGGCTGAATCTGGGCCCTTCCGTCCT
GGCTGGAGTGGCGGTGATGGTCCTCATGGTGCCCGTCAATGCTGTGATGGCGATGAAGACCAAGACGTAT
CAGGTGGCCCACATGAAGAGCAAAGACAATCGGATCAAGCTGATGAACGAAATTCTCAATGGGATCAAAG
TGCTAAAGCTTTATGCCTGGGAGCTGGCATTCAAGGACAAGGTGCTGGCCATCAGGCAGGAGGAGCTGAA
GGTGCTGAAGAAGTCTGCCTACCTGTCAGCCGTGGGCACCTTCACCTGGGTCTGCACGCCCTTTCTGGTG
GCCCTGTGCACATTTGCCGTCTACGTGACCATTGACGAGAACAACATCCTGGATGCCCAGACAGCCTTCG
TGTCTTTGGCCTTGTTCAACATCCTCCGGTTTCCCCTGAACATTCTCCCCATGGTCATCAGCAGCATCGT
GCAGGCGAGTGTCTCCCTCAAACGCCTGAGGATCTTTCTCTCCCATGAGGAGCTGGAACCTGACAGCATC
GAGCGACGGCCTGTCAAAGACGGCGGGGGCACGAACAGCATCACCGTGAGGAATGCCACATTCACCTGGG
CCAGGAGCGACCCTCCCACACTGAATGGCATCACCTTCTCCATCCCCGAAGGTGCTTTGGTGGCCGTGGT
GGGCCAGGTGGGCTGCGGAAAGTCGTCCCTGCTCTCAGCCCTCTTGGCTGAGATGGACAAAGTGGAGGGG
CACGTGGCTATCAAGGGCTCCGTGGCCTATGTGCCACAGCAGGCCTGGATTCAGAATGATTCTCTCCGAG
AAAACATCCTTTTTGGATGTCAGCTGGAGGAACCATATTACAGGTCCGTGATACAGGCCTGTGCCCTCCT
CCCAGACCTGGAAATCCTGCCCAGTGGGGATCGGACAGAGATTGGCGAGAAGGGCGTGAACCTGTCTGGG
GGCCAGAAGCAGCGCGTGAGCCTGGCCCGGGCCGTGTACTCCAACGCTGACATTTACCTCTTCGATGATC
CCCTCTCAGCAGTGGATGCCCATGTGGGAAAACACATCTTTGAAAATGTGATTGGCCCCAAGGGGATGCT
GAAGAACAAGACGCGGATCTTGGTCACGCACAGCATGAGCTACTTGCCGCAGGTGGACGTCATCATCGTC
ATGAGTGGCGGCAAGATCTCTGAGATGGGCTCCTACCAGGAGCTGCTGGCTCGAGACGGCGCCTTCGCTG
AGTTCCTGCGTACCTATGCCAGCACAGAGCAGGAGCAGGATGCAGAGGAGAACGGGGTCACGGGCGTCAG
CGGTCCAGGGAAGGAAGCAAAGCAAATGGAGAATGGCATGCTGGTGACGGACAGTGCAGGGAAGCAACTG
CAGAGACAGCTCAGCAGCTCCTCCTCCTATAGTGGGGACATCAGCAGGCACCACAACAGCACCGCAGAAC
TGCAGAAAGCTGAGGCCAAGAAGGAGGAGACCTGGAAGCTGATGGAGGCTGACAAGGCGCAGACAGGGCA
GGTCAAGCTTTCCGTGTACTGGGACTACATGAAGGCCATCGGACTCTTCATCTCCTTCCTCAGCATCTTC
CTTTTCATGTGTAACCATGTGTCCGCGCTGGCTTCCAACTATTGGCTCAGCCTCTGGACTGATGACCCCA
TCGTCAACGGGACTCAGGAGCACACGAAAGTCCGGCTGAGCGTCTATGGAGCCCTGGGCATTTCACAAGG
GATCGCCGTGTTTGGCTACTCCATGGCCGTGTCCATCGGGGGGATCTTGGCTTCCCGCTGTCTGCACGTG
GACCTGCTGCACAGCATCCTGCGGTCACCCATGAGCTTCTTTGAGCGGACCCCCAGTGGGAACCTGGTGA
ACCGCTTCTCCAAGGAGCTGGACACAGTGGACTCCATGATCCCGGAGGTCATCAAGATGTTCATGGGCTC
CCTGTTCAACGTCATTGGTGCCTGCATCGTTATCCTGCTGGCCACGCCCATCGCCGCCATCATCATCCCG
CCCCTTGGCCTCATCTACTTCTTCGTCCAGAGGTTCTACGTGGCTTCCTCCCGGCAGCTGAAGCGCCTCG
AGTCGGTCAGCCGCTCCCCGGTCTATTCCCATTTCAACGAGACCTTGCTGGGGGTCAGCGTCATTCGAGC
CTTCGAGGAGCAGGAGCGCTTCATCCACCAGAGTGACCTGAAGGTGGACGAGAACCAGAAGGCCTATTAC
CCCAGCATCGTGGCCAACAGGTGGCTGGCCGTGCGGCTGGAGTGTGTGGGCAACTGCATCGTTCTGTTTG
CTGCCCTGTTTGCGGTGATCTCCAGGCACAGCCTCAGTGCTGGCTTGGTGGGCCTCTCAGTGTCTTACTC
ATTGCAGGTCACCACGTACTTGAACTGGCTGGTTCGGATGTCATCTGAAATGGAAACCAACATCGTGGCC
GTGGAGAGGCTCAAGGAGTATTCAGAGACTGAGAAGGAGGCGCCCTGGCAAATCCAGGAGACAGCTCCGC
CCAGCAGCTGGCCCCAGGTGGGCCGAGTGGAATTCCGGAACTACTGCCTGCGCTACCGAGAGGACCTGGA
CTTCGTTCTCAGGCACATCAATGTCACGATCAATGGGGGAGAAAAGGTCGGCATCGTGGGGCGGACGGGA
GCTGGGAAGTCGTCCCTGACCCTGGGCTTATTTCGGATCAACGAGTCTGCCGAAGGAGAGATCATCATCG
ATGGCATCAACATCGCCAAGATCGGCCTGCACGACCTCCGCTTCAAGATCACCATCATCCCCCAGGACCC
TGTTTTGTTTTCGGGTTCCCTCCGAATGAACCTGGACCCATTCAGCCAGTACTCGGATGAAGAAGTCTGG
ACGTCCCTGGAGCTGGCCCACCTGAAGGACTTCGTGTCAGCCCTTCCTGACAAGCTAGACCATGAATGTG
CAGAAGGCGGGGAGAACCTCAGTGTCGGGCAGCGCCAGCTTGTGTGCCTAGCCCGGGCCCTGCTGAGGAA
GACGAAGATCCTTGTGTTGGATGAGGCCACGGCAGCCGTGGACCTGGAAACGGACGACCTCATCCAGTCC
ACCATCCGGACACAGTTCGAGGACTGCACCGTCCTCACCATCGCCCACCGGCTCAACACCATCATGGACT
ACACAAGGGTGATCGTCTTGGACAAAGGAGAAATCCAGGAGTACGGCGCCCCATCGGACCTCCTGCAGCA
GAGAGGTCTTTTCTACAGCATGGCCAAAGACGCCGGCTTGGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC218182 representing NM_004996
Red=Cloning site Green=Tags(s)

MALRGFCSADGSDPLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLWACFPFYFLYLSRHDRGYIQMTPL
NKTKTALGFLLWIVCWADLFYSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLT
FWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFSLLLIQLVLSCFSDRSPLFSETIHDPNPCPE
SSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSK
DPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLI
KFVNDTKAPDWQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTV
GEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTY
QVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLV
ALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSI
ERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEG
HVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSG
GQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIV
MSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQL
QRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIF
LFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHV
DLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIP
PLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYY
PSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVA
VERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTG
AGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVW
TSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQS
TIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAKDAGLV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004996
ORF Size 4593 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004996.1, NM_004996.2, NM_004996.3, NP_004987.1
RefSeq Size 5927 bp
RefSeq ORF 4596 bp
Locus ID 4363
Cytogenetics 16p13.11
Domains ABC_membrane, ABC_tran, AAA
Protein Families Druggable Genome, Transmembrane
Protein Pathways ABC transporters
MW 171.4 kDa
Gene Summary The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternatively spliced variants of this gene have been described but their full-length nature is unknown. [provided by RefSeq, Apr 2012]

Citations (1)

Other Versions

Other products for "ABCC1"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Mouse Monoclonal MRP1 Antibody (IU5C1)
    • 100 ul

USD 410.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools