ARID1A (NM_006015) Human Tagged ORF Clone

CAT#: RC218151

ARID1A (Myc-DDK-tagged)-Human AT rich interactive domain 1A (SWI-like) (ARID1A), transcript variant 1

Clone Modification / Custom Cloning Service

USD 1,999.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ARID1A (NM_006015) Human Tagged ORF Clone
Symbol ARID1A
Synonyms B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Vector pCMV6-Entry
Sequence Data
>RC218151 representing NM_006015
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGC
TGAAGAAAGCCGAGCAGCAGCAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCG
CGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGCCCCGCCGTGGGGCCGCCGCAGCCGCTGGGA
AAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGCGGCGGCGGGC
CCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCT
CACGGAGCCGCCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCG
GCCGCCTTGCCGCCCCCAGCCTACGGCTTCGGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCG
CCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGCCTGGCAGCGCTGCAGAGCGG
CGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCC
CGAGAGGTGGCACTCCGGGCTCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGC
CTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGCTTCGGGGCCATGGGGGGAGGCGGCCCCTCC
GCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACGTCGCCCAGCT
CGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAA
GGGCCCGGCGGACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCG
GGAGGGGCCCAACAAAGGAGCCACCACGCGCCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGC
TCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATGAGACCTCAGCCATATGGCGG
GACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCG
GCCTCTCTTATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCA
GACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCG
TCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAGCTCCAGTCCT
CTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCA
GCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTAC
CAGCAGCAGCAACCTCAGCAGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGT
CTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCGCAGGAGCTATCTCAAGATTC
ATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG
AGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAG
AAGGAGCTCTGAGTCCTGGAGTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGC
TCAGTCTCCTTTCTCTCCTCATACCTCCCCTCACCTGCCTGGCATCCGAGGCCCTTCCCCGTCCCCTGTT
GGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCAGGCAACCAGA
TGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTGC
CCAAGATCGAGGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCC
TTATCTCCGCGTCAGCCTTCCGGAGGACAGATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGG
GGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAGGTGGCTACCCCAGGCAGCCAAACTATAATGC
CTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTGCCGGAGGTCAA
ATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGG
GCAACCGGCCTTATGGCCCTAACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACC
AGGGGGCATGAACCGGAAAACCCAAGAAACTGCTGTCGCCATGCATGTTGCTGCCAACTCTATCCAAAAC
AGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTGGACCTCCTTATGGACAAGGGA
TTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACAA
TTCTGCAGGGATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAA
ATGAACAACAAGGCAGATGGGACACCCAAGACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAA
CCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGGAAGATGTGGGTGGACCGTTA
TCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGAAACCTCTGGAC
CTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGC
GGGAACTTGCAACCAACCTCAATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATAT
CCAGTGTCTCTATGCCTTTGAATGCAAGATTGAACGGGGAGAAGACCCTCCCCCAGACATCTTTGCAGCT
GCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGGGATCAGGATCTATGCAGGGGC
CCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCATC
CACACCACACAGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCC
TTTAATGATGGAAGTGACTCCACATTCCAGAAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCA
GTATGAATACCTCTGACATGATGGGGCGCATGTCCTATGAGCCAAATAAGGATCCTTATGGCAGCATGAG
GAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTAC
AGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTC
CTTATGACAGAGTGAGGACGGAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCC
GAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCTCCTAGCCGCTACCCCCCGCAGCAGCAGCAG
CAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCTGGCAGCCCCT
TCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTACAAGCGGCCAATGGATGGCACATA
TGGCCCTCCTGCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCAGCCT
CAGCAGCAGCAGTTGCCCCCAGCCCAGCCCCAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTC
AGCAAGATGTATACAACCAGTATGGCAATGCCTATCCTGCCACTGCCACAGCTGCTACTGAGCGCCGACC
AGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTTTGGCCGAGACCGTGTCTCTGCACCCCCTGGCACC
AATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGCTGAGGTTGCTCAGC
AAGGCACCATGTGGCAGGGGCGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGC
CCCCCAGGGCCCCGCCTATCATGGCGTGAACCGAACAGATGAAATGCTGCACACAGATCAGAGGGCCAAC
CACGAAGGCTCGTGGCCTTCCCATGGCACACGCCAGCCCCCATATGGTCCCTCTGCCCCTGTGCCCCCCA
TGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCAGAATCACATTCCTCAGGTATCCAG
CCCTGCTCCCCTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGG
ATGAAAATGCAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCA
TGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAG
GCGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTC
CTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCT
TCAACCTCAGTCAGCTCCCAGGGTTGCTAGAGCTCCTTGTAGAATATTTCCGACGATGCCTGATTGAGAT
CTTTGGCATTTTAAAGGAGTATGAGGTGGGTGACCCAGGACAGAGAACGCTACTGGATCCTGGGAGGTTC
AGCAAGGTGTCTAGTCCAGCTCCCATGGAGGGTGGGGAAGAAGAAGAAGAACTTCTAGGTCCTAAACTAG
AAGAGGAAGAAGAAGAGGAAGTAGTTGAAAATGATGAGGAGATAGCCTTTTCAGGCAAGGACAAGCCAGC
TTCAGAGAATAGTGAGGAGAAGCTGATCAGTAAGTTTGACAAGCTTCCAGTAAAGATCGTACAGAAGAAT
GATCCATTTGTGGTGGACTGCTCAGATAAGCTTGGGCGTGTGCAGGAGTTTGACAGTGGCCTGCTGCACT
GGCGGATTGGTGGGGGGGACACCACTGAGCATATCCAGACCCACTTCGAGAGCAAGACAGAGCTGCTGCC
TTCCCGGCCTCACGCACCCTGCCCACCAGCCCCTCGGAAGCATGTGACAACAGCAGAGGGTACACCAGGG
ACAACAGACCAGGAGGGGCCCCCACCTGATGGACCTCCAGAAAAACGGATCACAGCCACTATGGATGACA
TGTTGTCTACTCGGTCTAGCACCTTGACCGAGGATGGAGCTAAGAGTTCAGAGGCCATCAAGGAGAGCAG
CAAGTTTCCATTTGGCATTAGCCCAGCACAGAGCCACCGGAACATCAAGATCCTAGAGGACGAACCCCAC
AGTAAGGATGAGACCCCACTGTGTACCCTTCTGGACTGGCAGGATTCTCTTGCCAAGCGCTGCGTCTGTG
TGTCCAATACCATTCGAAGCCTGTCATTTGTGCCAGGCAATGACTTTGAGATGTCCAAACACCCAGGGCT
GCTGCTCATCCTGGGCAAGCTGATCCTGCTGCACCACAAGCACCCAGAACGGAAGCAGGCACCACTAACT
TATGAAAAGGAGGAGGAACAGGACCAAGGGGTGAGCTGCAACAAAGTGGAGTGGTGGTGGGACTGCTTGG
AGATGCTCCGGGAAAACACCTTGGTTACACTCGCCAACATCTCGGGGCAGTTGGACCTATCTCCATACCC
CGAGAGCATTTGCCTGCCTGTCCTGGACGGACTCCTACACTGGGCAGTTTGCCCTTCAGCTGAAGCCCAG
GACCCCTTTTCCACCCTGGGCCCCAATGCCGTCCTTTCCCCGCAGAGACTGGTCTTGGAAACCCTCAGCA
AACTCAGCATCCAGGACAACAATGTGGACCTGATTCTGGCCACACCCCCCTTCAGCCGCCTGGAGAAGTT
GTATAGCACTATGGTGCGCTTCCTCAGTGACCGAAAGAACCCGGTGTGCCGGGAGATGGCTGTGGTACTG
CTGGCCAACCTGGCTCAGGGGGACAGCCTGGCAGCTCGTGCCATTGCAGTGCAGAAGGGCAGTATCGGCA
ACCTCCTGGGCTTCCTAGAGGACAGCCTTGCCGCCACACAGTTCCAGCAGAGCCAGGCCAGCCTCCTCCA
CATGCAGAACCCACCCTTTGAGCCAACTAGTGTGGACATGATGCGGCGGGCTGCCCGCGCGCTGCTTGCC
TTGGCCAAGGTGGACGAGAACCACTCAGAGTTTACTCTGTACGAATCACGGCTGTTGGACATCTCGGTAT
CACCGTTGATGAACTCATTGGTTTCACAAGTCATTTGTGATGTACTGTTTTTGATTGGCCAGTCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC218151 representing NM_006015
Red=Cloning site Green=Tags(s)

MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLG
KELQDGAESNGGGGGGGAGSGGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAA
AALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPGLAALQSGGGGGLEPYAGPQQNSHDHGFPNH
QYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQRFGAMGGGGPS
AAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAAS
GGAQQRSHHAPMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQ
PYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPP
SQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPPYSQPQAQSPY
QQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNL
SLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPV
GSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSA
LSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGINPMGAGGQ
MHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVAMHVAANSIQN
RPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATK
MNNKADGTPKTESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLD
LYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAA
ADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDA
FNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPY
SRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQ
QQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSTGQGQP
QQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATATAATERRPAGGPQNQFPFQFGRDRVSAPPGT
NAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRAN
HEGSWPSHGTRQPPYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSG
MKMQKAGPPVPASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGL
LAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEVGDPGQRTLLDPGRF
SKVSSPAPMEGGEEEEELLGPKLEEEEEEEVVENDEEIAFSGKDKPASENSEEKLISKFDKLPVKIVQKN
DPFVVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFESKTELLPSRPHAPCPPAPRKHVTTAEGTPG
TTDQEGPPPDGPPEKRITATMDDMLSTRSSTLTEDGAKSSEAIKESSKFPFGISPAQSHRNIKILEDEPH
SKDETPLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLT
YEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQ
DPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVL
LANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLA
LAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLFLIGQS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_006015
ORF Size 6855 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_006015.3, NM_006015.4, NP_006006
RefSeq Size 8595
RefSeq ORF 6858
Locus ID 8289
Cytogenetics 1p36.11
Protein Families Druggable Genome
MW 241.9 kDa
Gene Summary This gene encodes a member of the SWI/SNF family, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation. It is thought that the protein encoded by this gene confers specificity to the SNF/SWI complex and may recruit the complex to its targets through either protein-DNA or protein-protein interactions. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)