SIRT1 (NM_012238) Human Tagged ORF Clone

CAT#: RC218134

Reviews ()
Write a review
  • TrueORF®

SIRT1 (Myc-DDK-tagged)-Human sirtuin 1 (SIRT1), transcript variant 1



Reconstitution Protocol

USD 684.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "SIRT1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SIRT1
Synonyms SIR2; SIR2alpha; SIR2L1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC218134 representing NM_012238
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGACGAGGCGGCCCTCGCCCTTCAGCCCGGCGGCTCCCCCTCGGCGGCGGGGGCCGACAGGGAGG
CCGCGTCGTCCCCCGCCGGGGAGCCGCTCCGCAAGAGGCCGCGGAGAGATGGTCCCGGCCTCGAGCGGAG
CCCGGGCGAGCCCGGTGGGGCGGCCCCAGAGCGTGAGGTGCCGGCGGCGGCCAGGGGCTGCCCGGGTGCG
GCGGCGGCGGCGCTGTGGCGGGAGGCGGAGGCAGAGGCGGCGGCGGCAGGCGGGGAGCAAGAGGCCCAGG
CGACTGCGGCGGCTGGGGAAGGAGACAATGGGCCGGGCCTGCAGGGCCCATCTCGGGAGCCACCGCTGGC
CGACAACTTGTACGACGAAGACGACGACGACGAGGGCGAGGAGGAGGAAGAGGCGGCGGCGGCGGCGATT
GGGTACCGAGATAACCTTCTGTTCGGTGATGAAATTATCACTAATGGTTTTCATTCCTGTGAAAGTGATG
AGGAGGATAGAGCCTCACATGCAAGCTCTAGTGACTGGACTCCAAGGCCACGGATAGGTCCATATACTTT
TGTTCAGCAACATCTTATGATTGGCACAGATCCTCGAACAATTCTTAAAGATTTATTGCCGGAAACAATA
CCTCCACCTGAGTTGGATGATATGACACTGTGGCAGATTGTTATTAATATCCTTTCAGAACCACCAAAAA
GGAAAAAAAGAAAAGATATTAATACAATTGAAGATGCTGTGAAATTACTGCAAGAGTGCAAAAAAATTAT
AGTTCTAACTGGAGCTGGGGTGTCTGTTTCATGTGGAATACCTGACTTCAGGTCAAGGGATGGTATTTAT
GCTCGCCTTGCTGTAGACTTCCCAGATCTTCCAGATCCTCAAGCGATGTTTGATATTGAATATTTCAGAA
AAGATCCAAGACCATTCTTCAAGTTTGCAAAGGAAATATATCCTGGACAATTCCAGCCATCTCTCTGTCA
CAAATTCATAGCCTTGTCAGATAAGGAAGGAAAACTACTTCGCAACTATACCCAGAACATAGACACGCTG
GAACAGGTTGCGGGAATCCAAAGGATAATTCAGTGTCATGGTTCCTTTGCAACAGCATCTTGCCTGATTT
GTAAATACAAAGTTGACTGTGAAGCTGTACGAGGAGATATTTTTAATCAGGTAGTTCCTCGATGTCCTAG
GTGCCCAGCTGATGAACCGCTTGCTATCATGAAACCAGAGATTGTGTTTTTTGGTGAAAATTTACCAGAA
CAGTTTCATAGAGCCATGAAGTATGACAAAGATGAAGTTGACCTCCTCATTGTTATTGGGTCTTCCCTCA
AAGTAAGACCAGTAGCACTAATTCCAAGTTCCATACCCCATGAAGTGCCTCAGATATTAATTAATAGAGA
ACCTTTGCCTCATCTGCATTTTGATGTAGAGCTTCTTGGAGACTGTGATGTCATAATTAATGAATTGTGT
CATAGGTTAGGTGGTGAATATGCCAAACTTTGCTGTAACCCTGTAAAGCTTTCAGAAATTACTGAAAAAC
CTCCACGAACACAAAAAGAATTGGCTTATTTGTCAGAGTTGCCACCCACACCTCTTCATGTTTCAGAAGA
CTCAAGTTCACCAGAAAGAACTTCACCACCAGATTCTTCAGTGATTGTCACACTTTTAGACCAAGCAGCT
AAGAGTAATGATGATTTAGATGTGTCTGAATCAAAAGGTTGTATGGAAGAAAAACCACAGGAAGTACAAA
CTTCTAGGAATGTTGAAAGTATTGCTGAACAGATGGAAAATCCGGATTTGAAGAATGTTGGTTCTAGTAC
TGGGGAGAAAAATGAAAGAACTTCAGTGGCTGGAACAGTGAGAAAATGCTGGCCTAATAGAGTGGCAAAG
GAGCAGATTAGTAGGCGGCTTGATGGTAATCAGTATCTGTTTTTGCCACCAAATCGTTACATTTTCCATG
GCGCTGAGGTATATTCAGACTCTGAAGATGACGTCTTATCCTCTAGTTCTTGTGGCAGTAACAGTGATAG
TGGGACATGCCAGAGTCCAAGTTTAGAAGAACCCATGGAGGATGAAAGTGAAATTGAAGAATTCTACAAT
GGCTTAGAAGATGAGCCTGATGTTCCAGAGAGAGCTGGAGGAGCTGGATTTGGGACTGATGGAGATGATC
AAGAGGCAATTAATGAAGCTATATCTGTGAAACAGGAAGTAACAGACATGAACTATCCATCAAACAAATC
A


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC218134 representing NM_012238
Red=Cloning site Green=Tags(s)

MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGA
AAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAI
GYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETI
PPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIY
ARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTL
EQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPE
QFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELC
HRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAA
KSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAK
EQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYN
GLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_012238
ORF Size 2241 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_012238.5
RefSeq Size 4107 bp
RefSeq ORF 2244 bp
Locus ID 23411
UniProt ID Q96EB6
Cytogenetics 10q21.3
Domains SIR2
Protein Families Druggable Genome, Stem cell - Pluripotency, Transcription Factors
MW 81.5 kDa
Gene Summary This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.