RBPJK (RBPJ) (NM_005349) Human Tagged ORF Clone

CAT#: RC218121

Reviews ()
Write a review

RBPJ (Myc-DDK-tagged)-Human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 1



Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product images

Other products for "RBPJ"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RBPJ
Synonyms AOS3; CBF-1; CBF1; csl; IGKJRB; IGKJRB1; KBF2; RBP-J; RBP-JK; RBP-J kappa; RBPJK; RBPSUH; SUH
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC218121 representing NM_005349
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCACACGGAGGGCTCGCCCGCGGAGGAGCCGCCTGCGCATGCTCCATCGCCTGGGAAATTTGGTG
AGCGGCCTCCACCTAAACGACTTACTAGGGAAGCTATGCGAAATTATTTAAAAGAGCGAGGGGATCAAAC
AGTACTTATTCTTCATGCAAAAGTTGCACAGAAGTCATATGGAAATGAAAAAAGGTTTTTTTGCCCACCT
CCTTGTGTATATCTTATGGGCAGTGGATGGAAGAAAAAAAAAGAACAAATGGAACGCGATGGTTGTTCTG
AACAAGAGTCTCAACCGTGTGCATTTATTGGGATAGGAAATAGTGACCAAGAAATGCAGCAGCTAAACTT
GGAAGGAAAGAACTATTGCACAGCCAAAACATTGTATATATCTGACTCAGACAAGCGAAAGCACTTCATG
TTGTCTGTAAAGATGTTCTATGGCAACAGTGATGACATTGGTGTGTTCCTCAGCAAGCGGATAAAAGTCA
TCTCCAAACCTTCCAAAAAGAAGCAGTCATTGAAAAATGCTGACTTATGCATTGCCTCAGGAACAAAGGT
GGCTCTGTTTAATCGACTACGATCCCAGACAGTTAGTACCAGATACTTGCATGTAGAAGGAGGTAATTTT
CATGCCAGTTCACAGCAGTGGGGAGCCTTTTTTATTCATCTCTTGGATGATGATGAATCAGAAGGAGAAG
AATTCACAGTCCGAGATGGCTACATCCATTATGGACAAACAGTCAAACTTGTGTGCTCAGTTACTGGCAT
GGCACTCCCAAGATTGATAATTAGGAAAGTTGATAAGCAGACCGCATTATTGGATGCAGATGATCCTGTG
TCACAACTCCATAAATGTGCATTTTACCTTAAGGATACAGAAAGAATGTATTTGTGCCTTTCTCAAGAAA
GAATAATTCAATTTCAGGCCACTCCATGTCCAAAAGAACCAAATAAAGAGATGATAAATGATGGCGCTTC
CTGGACAATCATTAGCACAGATAAGGCAGAGTATACATTTTATGAGGGAATGGGCCCTGTCCTTGCCCCA
GTCACTCCTGTGCCTGTGGTAGAGAGCCTTCAGTTGAATGGCGGTGGGGACGTAGCAATGCTTGAACTTA
CAGGACAGAATTTCACTCCAAATTTACGAGTGTGGTTTGGGGATGTAGAAGCTGAAACTATGTACAGGTG
TGGAGAGAGTATGCTCTGTGTCGTCCCAGACATTTCTGCATTCCGAGAAGGTTGGAGATGGGTCCGGCAA
CCAGTCCAGGTTCCAGTAACTTTGGTCCGAAATGATGGAATCATTTATTCCACCAGCCTTACCTTTACCT
ACACACCAGAACCAGGGCCGCGGCCACATTGCAGTGCAGCAGGAGCAATCCTTCGAGCCAATTCAAGCCA
GGTGCCCCCTAACGAATCAAACACAAACAGCGAGGGAAGTTACACAAACGCCAGCACAAATTCAACCAGT
GTCACATCATCTACAGCCACAGTGGTATCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC218121 representing NM_005349
Red=Cloning site Green=Tags(s)

MDHTEGSPAEEPPAHAPSPGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPP
PCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFM
LSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTVSTRYLHVEGGNF
HASSQQWGAFFIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPV
SQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAP
VTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQ
PVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTS
VTSSTATVVS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005349
ORF Size 1500 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005349.4
RefSeq Size 2388 bp
RefSeq ORF 1503 bp
Locus ID 3516
UniProt ID Q06330
Cytogenetics 4p15.2
Protein Families Transcription Factors
Protein Pathways Notch signaling pathway
MW 55.5 kDa
Gene Summary The protein encoded by this gene is a transcriptional regulator important in the Notch signaling pathway. The encoded protein acts as a repressor when not bound to Notch proteins and an activator when bound to Notch proteins. It is thought to function by recruiting chromatin remodeling complexes containing histone deacetylase or histone acetylase proteins to Notch signaling pathway genes. Several transcript variants encoding different isoforms have been found for this gene, and several pseudogenes of this gene exist on chromosome 9. [provided by RefSeq, Oct 2013]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.