Argonaute 2(AGO2) (NM_012154) Human Tagged ORF Clone

CAT#: RC218078

AGO2 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 2C, 2 (EIF2C2), transcript variant 1

Change vector?

USD 1,319


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Argonaute 2(AGO2) (NM_012154) Human Tagged ORF Clone
Symbol AGO2
Synonyms EIF2C2; Q10
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC218078 representing NM_012154
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTACTCGGGAGCCGGCCCCGCACTTGCACCTCCTGCGCCGCCGCCCCCCATCCAAGGATATGCCTTCA
AGCCTCCACCTAGACCCGACTTTGGGACCTCCGGGAGAACAATCAAATTACAGGCCAATTTCTTCGAAAT
GGACATCCCCAAAATTGACATCTATCATTATGAATTGGATATCAAGCCAGAGAAGTGCCCGAGGAGAGTT
AACAGGGAAATCGTGGAACACATGGTCCAGCACTTTAAAACACAGATCTTTGGGGATCGGAAGCCCGTGT
TTGACGGCAGGAAGAATCTATACACAGCCATGCCCCTTCCGATTGGGAGGGACAAGGTGGAGCTGGAGGT
CACGCTGCCAGGAGAAGGCAAGGATCGCATCTTCAAGGTGTCCATCAAGTGGGTGTCCTGCGTGAGCTTG
CAGGCGTTACACGATGCACTTTCAGGGCGGCTGCCCAGCGTCCCTTTTGAGACGATCCAGGCCCTGGACG
TGGTCATGAGGCACTTGCCATCCATGAGGTACACCCCCGTGGGCCGCTCCTTCTTCACCGCGTCCGAAGG
CTGCTCTAACCCTCTTGGCGGGGGCCGAGAAGTGTGGTTTGGCTTCCATCAGTCCGTCCGGCCTTCTCTC
TGGAAAATGATGCTGAATATTGATGTGTCAGCAACAGCGTTTTACAAGGCACAGCCAGTAATCGAGTTTG
TTTGTGAAGTTTTGGATTTTAAAAGTATTGAAGAACAACAAAAACCTCTGACAGATTCCCAAAGGGTAAA
GTTTACCAAAGAAATTAAAGGTCTAAAGGTGGAGATAACGCACTGTGGGCAGATGAAGAGGAAGTACCGC
GTCTGCAATGTGACCCGGCGGCCCGCCAGTCACCAAACATTCCCGCTGCAGCAGGAGAGCGGGCAGACGG
TGGAGTGCACGGTGGCCCAGTATTTCAAGGACAGGCACAAGTTGGTTCTGCGCTACCCCCACCTCCCATG
TTTACAAGTCGGACAGGAGCAGAAACACACCTACCTTCCCCTGGAGGTCTGTAACATTGTGGCAGGACAA
AGATGTATTAAAAAATTAACGGACAATCAGACCTCAACCATGATCAGAGCGACTGCTAGGTCGGCGCCCG
ATCGGCAAGAAGAGATTAGCAAATTGATGCGAAGTGCAAGTTTCAACACAGATCCATACGTCCGTGAATT
TGGAATCATGGTCAAAGATGAGATGACAGACGTGACTGGGCGGGTGCTGCAGCCGCCCTCCATCCTCTAC
GGGGGCAGGAATAAAGCTATTGCGACCCCTGTCCAGGGCGTCTGGGACATGCGGAACAAGCAGTTCCACA
CGGGCATCGAGATCAAGGTGTGGGCCATTGCGTGCTTCGCCCCCCAGCGCCAGTGCACGGAAGTCCATCT
GAAGTCCTTCACAGAGCAGCTCAGAAAGATCTCGAGAGACGCCGGCATGCCCATCCAGGGCCAGCCGTGC
TTCTGCAAATACGCGCAGGGGGCGGACAGCGTGGAGCCCATGTTCCGGCACCTGAAGAACACGTATGCGG
GCCTGCAGCTGGTGGTGGTCATCCTGCCCGGCAAGACGCCCGTGTACGCCGAGGTCAAGCGCGTGGGAGA
CACGGTGCTGGGGATGGCCACGCAGTGCGTGCAGATGAAGAACGTGCAGAGGACCACGCCACAGACCCTG
TCCAACCTCTGCCTGAAGATCAACGTCAAGCTGGGAGGCGTGAACAACATCCTGCTGCCCCAGGGCAGGC
CGCCGGTGTTCCAGCAGCCCGTCATCTTTCTGGGAGCAGACGTCACTCACCCCCCCGCCGGGGATGGGAA
GAAGCCCTCCATTGCCGCCGTGGTGGGCAGCATGGACGCCCACCCCAATCGCTACTGCGCCACCGTGCGT
GTGCAGCAGCACCGGCAGGAGATCATACAAGACCTGGCCGCCATGGTCCGCGAGCTCCTCATCCAGTTCT
ACAAGTCCACGCGCTTCAAGCCCACCCGCATCATCTTCTACCGCGACGGTGTCTCTGAAGGCCAGTTCCA
GCAGGTTCTCCACCACGAGTTGCTGGCCATCCGTGAGGCCTGTATCAAGCTAGAAAAAGACTACCAGCCC
GGGATCACCTTCATCGTGGTGCAGAAGAGGCACCACACCCGGCTCTTCTGCACTGACAAGAACGAGCGGG
TTGGGAAAAGTGGAAACATTCCAGCAGGCACGACTGTGGACACGAAAATCACCCACCCCACCGAGTTCGA
CTTCTACCTGTGTAGTCACGCTGGCATCCAGGGGACAAGCAGGCCTTCGCACTATCACGTCCTCTGGGAC
GACAATCGTTTCTCCTCTGATGAGCTGCAGATCCTAACCTACCAGCTGTGTCACACCTACGTGCGCTGCA
CACGCTCCGTGTCCATCCCAGCGCCAGCATACTACGCTCACCTGGTGGCCTTCCGGGCCAGGTACCACCT
GGTGGATAAGGAACATGACAGTGCTGAAGGAAGCCATACCTCTGGGCAGAGTAACGGGCGAGACCACCAA
GCACTGGCCAAGGCGGTCCAGGTTCACCAAGACACTCTGCGCACCATGTACTTTGCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC218078 representing NM_012154
Red=Cloning site Green=Tags(s)

MYSGAGPALAPPAPPPPIQGYAFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELDIKPEKCPRRV
NREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKDRIFKVSIKWVSCVSL
QALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCSNPLGGGREVWFGFHQSVRPSL
WKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYR
VCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQ
RCIKKLTDNQTSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILY
GGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRDAGMPIQGQPC
FCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQTL
SNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVR
VQQHRQEIIQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQP
GITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWD
DNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTSGQSNGRDHQ
ALAKAVQVHQDTLRTMYFA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_012154
ORF Size 2577 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_012154.2, NM_012154.3, NM_012154.4, NP_036286
RefSeq Size 3567
RefSeq ORF 2580
Locus ID 27161
Cytogenetics 8q24.3
Domains PAZ, Piwi
Protein Families Druggable Genome
MW 97 kDa
Gene Summary This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations