HDAC9(HDAC9) (NM_178423) Human Tagged ORF Clone

CAT#: RC218061

HDAC9 (Myc-DDK-tagged)-Human histone deacetylase 9 (HDAC9), transcript variant 4

Clone Modification / Custom Cloning Service

USD 1,638.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HDAC9(HDAC9) (NM_178423) Human Tagged ORF Clone
Symbol HDAC9
Synonyms HD7; HD7b; HD9; HDAC; HDAC7; HDAC7B; HDAC9B; HDAC9FL; HDRP; MITR
Vector pCMV6-Entry
Sequence Data
>RC218061 representing NM_178423
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCACAGTATGATCAGCTCAGTGGATGTGAAGTCAGAAGTTCCTGTGGGCCTGGAGCCCATCTCACCTT
TAGACCTAAGGACAGACCTCAGGATGATGATGCCCGTGGTGGACCCTGTTGTCCGTGAGAAGCAATTGCA
GCAGGAATTACTTCTTATCCAGCAGCAGCAACAAATCCAGAAGCAGCTTCTGATAGCAGAGTTTCAGAAA
CAGCATGAGAACTTGACACGGCAGCACCAGGCTCAGCTTCAGGAGCATATCAAGGAACTTCTAGCCATAA
AACAGCAACAAGAACTCCTAGAAAAGGAGCAGAAACTGGAGCAGCAGAGGCAAGAACAGGAAGTAGAGAG
GCATCGCAGAGAACAGCAGCTTCCTCCTCTCAGAGGCAAAGATAGAGGACGAGAAAGGGCAGTGGCAAGT
ACAGAAGTAAAGCAGAAGCTTCAAGAGTTCCTACTGAGTAAATCAGCAACGAAAGACACTCCAACTAATG
GAAAAAATCATTCCGTGAGCCGCCATCCCAAGCTCTGGTACACGGCTGCCCACCACACATCATTGGATCA
AAGCTCTCCACCCCTTAGTGGAACATCTCCATCCTACAAGTACACATTACCAGGAGCACAAGATGCAAAG
GATGATTTCCCCCTTCGAAAAACTGCCTCTGAGCCCAACTTGAAGGTGCGGTCCAGGTTAAAACAGAAAG
TGGCAGAGAGGAGAAGCAGCCCCTTACTCAGGCGGAAGGATGGAAATGTTGTCACTTCATTCAAGAAGCG
AATGTTTGAGGTGACAGAATCCTCAGTCAGTAGCAGTTCTCCAGGCTCTGGTCCCAGTTCACCAAACAAT
GGGCCAACTGGAAGTGTTACTGAAAATGAGACTTCGGTTTTGCCCCCTACCCCTCATGCCGAGCAAATGG
TTTCACAGCAACGCATTCTAATTCATGAAGATTCCATGAACCTGCTAAGTCTTTATACCTCTCCTTCTTT
GCCCAACATTACCTTGGGGCTTCCCGCAGTGCCATCCCAGCTCAATGCTTCGAATTCACTCAAAGAAAAG
CAGAAGTGTGAGACGCAGACGCTTAGGCAAGGTGTTCCTCTGCCTGGGCAGTATGGAGGCAGCATCCCGG
CATCTTCCAGCCACCCTCATGTTACTTTAGAGGGAAAGCCACCCAACAGCAGCCACCAGGCTCTCCTGCA
GCATTTATTATTGAAAGAACAAATGCGACAGCAAAAGCTTCTTGTAGCTGGTGGAGTTCCCTTACATCCT
CAGTCTCCCTTGGCAACAAAAGAGAGAATTTCACCTGGCATTAGAGGTACCCACAAATTGCCCCGTCACA
GACCCCTGAACCGAACCCAGTCTGCACCTTTGCCTCAGAGCACGTTGGCTCAGCTGGTCATTCAACAGCA
ACACCAGCAATTCTTGGAGAAGCAGAAGCAATACCAGCAGCAGATCCACATGAACAAACTGCTTTCGAAA
TCTATTGAACAACTGAAGCAACCAGGCAGTCACCTTGAGGAAGCAGAGGAAGAGCTTCAGGGGGACCAGG
CGATGCAGGAAGACAGAGCGCCCTCTAGTGGCAACAGCACTAGGAGCGACAGCAGTGCTTGTGTGGATGA
CACACTGGGACAAGTTGGGGCTGTGAAGGTCAAGGAGGAACCAGTGGACAGTGATGAAGATGCTCAGATC
CAGGAAATGGAATCTGGGGAGCAGGCTGCTTTTATGCAACAGCCTTTCCTGGAACCCACGCACACACGTG
CGCTCTCTGTGCGCCAAGCTCCGCTGGCTGCGGTTGGCATGGATGGATTAGAGAAACACCGTCTCGTCTC
CAGGACTCACTCTTCCCCTGCTGCCTCTGTTTTACCTCACCCAGCAATGGACCGCCCCCTCCAGCCTGGC
TCTGCAACTGGAATTGCCTATGACCCCTTGATGCTGAAACACCAGTGCGTTTGTGGCAATTCCACCACCC
ACCCTGAGCATGCTGGACGAATACAGAGTATCTGGTCACGACTGCAAGAAACTGGGCTGCTAAATAAATG
TGAGCGAATTCAAGGTCGAAAAGCCAGCCTGGAGGAAATACAGCTTGTTCATTCTGAACATCACTCACTG
TTGTATGGCACCAACCCCCTGGACGGACAGAAGCTGGACCCCAGGATACTCCTAGGTGATGACTCTCAAA
AGTTTTTTTCCTCATTACCTTGTGGTGGACTTGGGGTGGACAGTGACACCATTTGGAATGAGCTACACTC
GTCCGGTGCTGCACGCATGGCTGTTGGCTGTGTCATCGAGCTGGCTTCCAAAGTGGCCTCAGGAGAGCTG
AAGAATGGGTTTGCTGTTGTGAGGCCCCCTGGCCATCACGCTGAAGAATCCACAGCCATGGGGTTCTGCT
TTTTTAATTCAGTTGCAATTACCGCCAAATACTTGAGAGACCAACTAAATATAAGCAAGATATTGATTGT
AGATCTGGATGTTCACCATGGAAACGGTACCCAGCAGGCCTTTTATGCTGACCCCAGCATCCTGTACATT
TCACTCCATCGCTATGATGAAGGGAACTTTTTCCCTGGCAGTGGAGCCCCAAATGAGGTTGGAACAGGCC
TTGGAGAAGGGTACAATATAAATATTGCCTGGACAGGTGGCCTTGATCCTCCCATGGGAGATGTTGAGTA
CCTTGAAGCATTCAGGACCATCGTGAAGCCTGTGGCCAAAGAGTTTGATCCAGACATGGTCTTAGTATCT
GCTGGATTTGATGCATTGGAAGGCCACACCCCTCCTCTAGGAGGGTACAAAGTGACGGCAAAATGTTTTG
GTCATTTGACGAAGCAATTGATGACATTGGCTGATGGACGTGTGGTGTTGGCTCTAGAAGGAGGACATGA
TCTCACAGCCATCTGTGATGCATCAGAAGCCTGTGTAAATGCCCTTCTAGGAAATGAGCTGGAGCCACTT
GCAGAAGATATTCTCCACCAAAGCCCGAATATGAATGCTGTTATTTCTTTACAGAAGATCATTGAAATTC
AAAGCAAGTATTGGAAGTCAGTAAGGATGGTGGCTGTGCCAAGGGGCTGTGCTCTGGCTGGTGCTCAGTT
GCAAGAGGAGACAGAGACCGTTTCTGCCCTGGCCTCCCTAACAGTGGATGTGGAACAGCCCTTTGCTCAG
GAAGACAGCAGAACTGCTGGTGAGCCTATGGAAGAGGAGCCAGCCTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC218061 representing NM_178423
Red=Cloning site Green=Tags(s)

MHSMISSVDVKSEVPVGLEPISPLDLRTDLRMMMPVVDPVVREKQLQQELLLIQQQQQIQKQLLIAEFQK
QHENLTRQHQAQLQEHIKELLAIKQQQELLEKEQKLEQQRQEQEVERHRREQQLPPLRGKDRGRERAVAS
TEVKQKLQEFLLSKSATKDTPTNGKNHSVSRHPKLWYTAAHHTSLDQSSPPLSGTSPSYKYTLPGAQDAK
DDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGNVVTSFKKRMFEVTESSVSSSSPGSGPSSPNN
GPTGSVTENETSVLPPTPHAEQMVSQQRILIHEDSMNLLSLYTSPSLPNITLGLPAVPSQLNASNSLKEK
QKCETQTLRQGVPLPGQYGGSIPASSSHPHVTLEGKPPNSSHQALLQHLLLKEQMRQQKLLVAGGVPLHP
QSPLATKERISPGIRGTHKLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQQIHMNKLLSK
SIEQLKQPGSHLEEAEEELQGDQAMQEDRAPSSGNSTRSDSSACVDDTLGQVGAVKVKEEPVDSDEDAQI
QEMESGEQAAFMQQPFLEPTHTRALSVRQAPLAAVGMDGLEKHRLVSRTHSSPAASVLPHPAMDRPLQPG
SATGIAYDPLMLKHQCVCGNSTTHPEHAGRIQSIWSRLQETGLLNKCERIQGRKASLEEIQLVHSEHHSL
LYGTNPLDGQKLDPRILLGDDSQKFFSSLPCGGLGVDSDTIWNELHSSGAARMAVGCVIELASKVASGEL
KNGFAVVRPPGHHAEESTAMGFCFFNSVAITAKYLRDQLNISKILIVDLDVHHGNGTQQAFYADPSILYI
SLHRYDEGNFFPGSGAPNEVGTGLGEGYNINIAWTGGLDPPMGDVEYLEAFRTIVKPVAKEFDPDMVLVS
AGFDALEGHTPPLGGYKVTAKCFGHLTKQLMTLADGRVVLALEGGHDLTAICDASEACVNALLGNELEPL
AEDILHQSPNMNAVISLQKIIEIQSKYWKSVRMVAVPRGCALAGAQLQEETETVSALASLTVDVEQPFAQ
EDSRTAGEPMEEEPAL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_178423
ORF Size 3198 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_178423.1, NM_178423.2, NP_848510
RefSeq Size 4659
RefSeq ORF 3201
Locus ID 9734
Cytogenetics 7p21.1
Protein Families Transcription Factors, Druggable Genome
MW 117 kDa
Gene Summary Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene has sequence homology to members of the histone deacetylase family. This gene is orthologous to the Xenopus and mouse MITR genes. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. This encoded protein may play a role in hematopoiesis. Multiple alternatively spliced transcripts have been described for this gene but the full-length nature of some of them has not been determined. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)