DEFB131A (NM_001040448) Human Tagged ORF Clone
CAT#: RC218014
DEFB131 (Myc-DDK-tagged)-Human defensin, beta 131 (DEFB131)
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
AAV Particle: DDK
"NM_001040448" in other vectors (6)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | DEFB131A |
Synonyms | DEFB-31; DEFB131 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC218014 representing NM_001040448
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGGGTCTTGTTTTTTGTCTTTGGAGTCCTTTCCTTGATGTTCACAGTTCCTCCAGGCAGAAGCTTCA TTTCTAATGATGAATGTCCTTCAGAATATTATCATTGCAGACTGAAGTGCAATGCTGATGAACATGCAAT TAGATACTGTGCTGACTTCAGCATCTGCTGCAAACTGAAGATCATTGAAATTGACGGACAAAAGAAGTGG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC218014 representing NM_001040448
Red=Cloning site Green=Tags(s) MRVLFFVFGVLSLMFTVPPGRSFISNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIEIDGQKKW myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001040448 |
ORF Size | 210 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001040448.1, NP_001035538.1 |
RefSeq Size | 213 bp |
RefSeq ORF | 213 bp |
Locus ID | 644414 |
UniProt ID | P59861 |
Cytogenetics | 4p16.1 |
Protein Families | Secreted Protein |
MW | 8 kDa |
Gene Summary | Defensins are cysteine-rich cationic polypeptides that are important in the immunologic response to invading microorganisms. The antimicrobial protein encoded by this gene is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 4p16. [provided by RefSeq, Nov 2014] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC218014L1 | Lenti ORF clone of Human defensin, beta 131 (DEFB131), Myc-DDK-tagged |
USD 450.00 |
|
RC218014L2 | Lenti ORF clone of Human defensin, beta 131 (DEFB131), mGFP tagged |
USD 450.00 |
|
RC218014L3 | Lenti ORF clone of Human defensin, beta 131 (DEFB131), Myc-DDK-tagged |
USD 450.00 |
|
RC218014L4 | Lenti ORF clone of Human defensin, beta 131 (DEFB131), mGFP tagged |
USD 450.00 |
|
RG218014 | DEFB131 (tGFP-tagged) - Human defensin, beta 131 (DEFB131) |
USD 350.00 |
|
SC310737 | DEFB131 (untagged)-Human defensin, beta 131 (DEFB131) |
USD 165.00 |
{0} Product Review(s)
Be the first one to submit a review