DEFB131 (NM_001040448) Human Tagged ORF Clone

CAT#: RC218014

DEFB131 (Myc-DDK-tagged)-Human defensin, beta 131 (DEFB131)

Change vector?

USD 402


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DEFB131 (NM_001040448) Human Tagged ORF Clone
Symbol DEFB131
Synonyms DEFB-31; DEFB-31
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC218014 representing NM_001040448
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGGTCTTGTTTTTTGTCTTTGGAGTCCTTTCCTTGATGTTCACAGTTCCTCCAGGCAGAAGCTTCA
TTTCTAATGATGAATGTCCTTCAGAATATTATCATTGCAGACTGAAGTGCAATGCTGATGAACATGCAAT
TAGATACTGTGCTGACTTCAGCATCTGCTGCAAACTGAAGATCATTGAAATTGACGGACAAAAGAAGTGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC218014 representing NM_001040448
Red=Cloning site Green=Tags(s)

MRVLFFVFGVLSLMFTVPPGRSFISNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIEIDGQKKW

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001040448
ORF Size 210 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001040448.1, NM_001040448.2, NP_001035538
RefSeq Size 213
RefSeq ORF 213
Locus ID 644414
Cytogenetics 4p16.1
Protein Families Secreted Protein
MW 8 kDa
Gene Summary Defensins are cysteine-rich cationic polypeptides that are important in the immunologic response to invading microorganisms. The antimicrobial protein encoded by this gene is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 4p16. [provided by RefSeq, Nov 2014].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations