POLR3G (NM_006467) Human Tagged ORF Clone
CAT#: RC217994
POLR3G (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide G (32kD) (POLR3G)
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
"NM_006467" in other vectors (6)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | POLR3G |
Synonyms | C31; RPC7; RPC32 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC217994 representing NM_006467
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTGGGAATAAAGGAAGAGGACGTGCTGCTTATACCTTTAATATTGAGGCTGTTGGATTTAGCAAAG GTGAAAAGTTACCTGATGTAGTGTTGAAACCACCCCCACTATTTCCTGATACAGATTATAAACCAGTGCC ACTGAAAACAGGAGAAGGTGAAGAATATATGCTGGCTTTGAAACAGGAGTTGAGAGAAACAATGAAAAGA ATGCCTTATTTTATTGAAACACCTGAAGAAAGACAAGATATTGAAAGGTATAGTAAAAGATACATGAAGG TATACAAGGAAGAATGGATACCAGATTGGAGAAGACTTCCAAGAGAGATGATGCCAAGAAATAAATGTAA AAAAGCAGGCCCAAAACCCAAAAAGGCAAAAGACGCAGGCAAAGGCACACCACTCACTAATACTGAAGAT GTGTTGAAAAAAATGGAGGAATTGGAAAAAAGAGGTGATGGTGAAAAATCAGATGAGGAAAATGAAGAGA AAGAAGGAAGCAAAGAGAAAAGTAAAGAAGGTGATGATGACGATGACGATGATGCCGCAGAACAGGAGGA ATATGATGAAGAAGAGCAAGAAGAGGAAAATGACTACATTAATTCATACTTTGAAGATGGAGATGATTTT GGCGCAGACAGTGATGACAACATGGATGAGGCAACCTAT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC217994 representing NM_006467
Red=Cloning site Green=Tags(s) MAGNKGRGRAAYTFNIEAVGFSKGEKLPDVVLKPPPLFPDTDYKPVPLKTGEGEEYMLALKQELRETMKR MPYFIETPEERQDIERYSKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAGPKPKKAKDAGKGTPLTNTED VLKKMEELEKRGDGEKSDEENEEKEGSKEKSKEGDDDDDDDAAEQEEYDEEEQEEENDYINSYFEDGDDF GADSDDNMDEATY myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_006467 |
ORF Size | 669 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_006467.3 |
RefSeq Size | 1000 bp |
RefSeq ORF | 672 bp |
Locus ID | 10622 |
UniProt ID | O15318 |
Cytogenetics | 5q14.3 |
Protein Pathways | Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
MW | 25.7 kDa |
Gene Summary | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs (PubMed:20154270). May direct with other members of the RPC3/POLR3C-RPC6/POLR3F-RPC7/POLR3G subcomplex RNA Pol III binding to the TFIIIB-DNA complex via the interactions between TFIIIB and POLR3F. May be involved either in the recruitment and stabilization of the subcomplex within RNA polymerase III, or in stimulating catalytic functions of other subunits during initiation. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs), induce type I interferon and NF- Kappa-B through the RIG-I pathway (PubMed:19609254, PubMed:19631370).[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC217994L1 | Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide G (32kD) (POLR3G), Myc-DDK-tagged |
USD 750.00 |
|
RC217994L2 | Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide G (32kD) (POLR3G), mGFP tagged |
USD 750.00 |
|
RC217994L3 | Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide G (32kD) (POLR3G), Myc-DDK-tagged |
USD 750.00 |
|
RC217994L4 | Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide G (32kD) (POLR3G), mGFP tagged |
USD 750.00 |
|
RG217994 | POLR3G (tGFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide G (32kD) (POLR3G) |
USD 650.00 |
|
SC303776 | POLR3G (untagged)-Human polymerase (RNA) III (DNA directed) polypeptide G (32kD) (POLR3G) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review