Repulsive Guidance Molecule C(HFE2) (NM_213653) Human Tagged ORF Clone

CAT#: RC217954

HFE2 (Myc-DDK-tagged)-Human hemochromatosis type 2 (juvenile) (HFE2), transcript variant a

Change vector?

  • TrueORF®

USD 546


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Repulsive Guidance Molecule C(HFE2) (NM_213653) Human Tagged ORF Clone
Symbol HFE2
Synonyms HFE2A; HJV; JH; RGMC
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC217954 representing NM_213653
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGGAGCCAGGCCAGTCCCCTAGTCCCAGGTCCTCCCATGGCAGTCCCCCAACTCTAAGCACTCTCA
CTCTCCTGCTGCTCCTCTGTGGACATGCTCATTCTCAATGCAAGATCCTCCGCTGCAATGCTGAGTACGT
ATCGTCCACTCTGAGCCTTAGAGGTGGGGGTTCATCAGGAGCACTTCGAGGAGGAGGAGGAGGAGGCCGG
GGTGGAGGGGTGGGCTCTGGCGGCCTCTGTCGAGCCCTCCGCTCCTATGCGCTCTGCACTCGGCGCACCG
CCCGCACCTGCCGCGGGGACCTCGCCTTCCATTCGGCGGTACATGGCATCGAAGACCTGATGATCCAGCA
CAACTGCTCCCGCCAGGGCCCTACAGCCCCTCCCCCGCCCCGGGGCCCCGCCCTTCCAGGCGCGGGCTCC
GGCCTCCCTGCCCCGGACCCTTGTGACTATGAAGGCCGGTTTTCCCGGCTGCATGGTCGTCCCCCGGGGT
TCTTGCATTGCGCTTCCTTCGGGGACCCCCATGTGCGCAGCTTCCACCATCACTTTCACACATGCCGTGT
CCAAGGAGCTTGGCCTCTACTGGATAATGACTTCCTCTTTGTCCAAGCCACCAGCTCCCCCATGGCGTTG
GGGGCCAACGCTACCGCCACCCGGAAGCTCACCATCATATTTAAGAACATGCAGGAATGCATTGATCAGA
AGGTGTATCAGGCTGAGGTGGATAATCTTCCTGTAGCCTTTGAAGATGGTTCTATCAATGGAGGTGACCG
ACCTGGGGGATCCAGTTTGTCGATTCAAACTGCTAACCCTGGGAACCATGTGGAGATCCAAGCTGCCTAC
ATTGGCACAACTATAATCATTCGGCAGACAGCTGGGCAGCTCTCCTTCTCCATCAAGGTAGCAGAGGATG
TGGCCATGGCCTTCTCAGCTGAACAGGACCTGCAGCTCTGTGTTGGGGGGTGCCCTCCAAGTCAGCGACT
CTCTCGATCAGAGCGCAATCGTCGGGGAGCTATAACCATTGATACTGCCAGACGGCTGTGCAAGGAAGGG
CTTCCAGTGGAAGATGCTTACTTCCATTCCTGTGTCTTTGATGTTTTAATTTCTGGTGATCCCAACTTTA
CCGTGGCAGCTCAGGCAGCACTGGAGGATGCCCGAGCCTTCCTGCCAGACTTAGAGAAGCTGCATCTCTT
CCCCTCAGATGCTGGGGTTCCTCTTTCCTCAGCAACCCTCTTAGCTCCACTCCTTTCTGGGCTCTTTGTT
CTGTGGCTTTGCATTCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC217954 representing NM_213653
Red=Cloning site Green=Tags(s)

MGEPGQSPSPRSSHGSPPTLSTLTLLLLLCGHAHSQCKILRCNAEYVSSTLSLRGGGSSGALRGGGGGGR
GGGVGSGGLCRALRSYALCTRRTARTCRGDLAFHSAVHGIEDLMIQHNCSRQGPTAPPPPRGPALPGAGS
GLPAPDPCDYEGRFSRLHGRPPGFLHCASFGDPHVRSFHHHFHTCRVQGAWPLLDNDFLFVQATSSPMAL
GANATATRKLTIIFKNMQECIDQKVYQAEVDNLPVAFEDGSINGGDRPGGSSLSIQTANPGNHVEIQAAY
IGTTIIIRQTAGQLSFSIKVAEDVAMAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAITIDTARRLCKEG
LPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPSDAGVPLSSATLLAPLLSGLFV
LWLCIQ

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_213653
ORF Size 1278 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_213653.1, NM_213653.2, NM_213653.3, NP_998818
RefSeq Size 2128
RefSeq ORF 1281
Locus ID 148738
Cytogenetics 1q21.1
Protein Families Transmembrane
MW 41.5 kDa
Gene Summary The product of this gene is involved in iron metabolism. It may be a component of the signaling pathway which activates hepcidin or it may act as a modulator of hepcidin expression. It could also represent the cellular receptor for hepcidin. Two uORFs in the 5' UTR negatively regulate the expression and activity of the encoded protein. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Defects in this gene are the cause of hemochromatosis type 2A, also called juvenile hemochromatosis (JH). JH is an early-onset autosomal recessive disorder due to severe iron overload resulting in hypogonadotrophic hypogonadism, hepatic fibrosis or cirrhosis and cardiomyopathy, occurring typically before age of 30. [provided by RefSeq, Oct 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations