hnRNP Q (SYNCRIP) (NM_006372) Human Tagged ORF Clone

CAT#: RC217902

Reviews ()
Write a review

SYNCRIP (Myc-DDK-tagged)-Human synaptotagmin binding, cytoplasmic RNA interacting protein (SYNCRIP), transcript variant 1



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 118.00

USD 847.00


Availability*
4 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SYNCRIP
Synonyms GRY-RBP; GRYRBP; hnRNP-Q; HNRNPQ; HNRPQ1; NSAP1; PP68
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC217902 representing NM_006372
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTACAGAACATGTTAATGGAAATGGTACTGAAGAGCCCATGGATACTACTTCTGCAGTTATCCATT
CAGAAAATTTTCAGACATTGCTTGATGCTGGTTTACCACAGAAAGTTGCTGAAAAACTAGATGAAATTTA
CGTTGCAGGGCTAGTTGCACATAGTGATTTAGATGAAAGAGCTATTGAAGCTTTAAAAGAATTCAATGAA
GACGGTGCATTGGCAGTTCTTCAACAGTTTAAAGACAGTGATCTCTCTCATGTTCAGAACAAAAGTGCCT
TTTTATGTGGAGTCATGAAGACTTACAGGCAGAGAGAAAAACAAGGGACCAAAGTAGCAGATTCTAGTAA
AGGACCAGATGAGGCAAAAATTAAGGCACTCTTGGAAAGAACAGGCTACACACTTGATGTGACCACTGGA
CAGAGGAAGTATGGAGGACCACCTCCAGATTCCGTTTATTCAGGTCAGCAGCCTTCTGTTGGCACTGAGA
TATTTGTGGGAAAGATCCCAAGAGATCTATTTGAGGATGAACTTGTTCCATTATTTGAGAAAGCTGGACC
TATATGGGATCTTCGTCTAATGATGGATCCACTCACTGGTCTCAATAGAGGTTATGCGTTTGTCACTTTT
TGTACAAAAGAAGCAGCTCAGGAGGCTGTTAAACTGTATAATAATCATGAAATTCGTTCTGGAAAACATA
TTGGTGTCTGCATCTCAGTTGCCAACAATAGGCTTTTTGTGGGCTCTATTCCTAAGAGTAAAACCAAGGA
ACAGATTCTTGAAGAATTTAGCAAAGTAACAGAGGGTCTTACAGACGTCATTTTATACCACCAACCGGAT
GACAAGAAAAAAAACAGAGGCTTTTGCTTTCTTGAATATGAAGATCACAAAACAGCTGCCCAGGCAAGGC
GTAGGTTAATGAGTGGTAAAGTCAAGGTCTGGGGGAATGTTGGAACTGTTGAATGGGCTGATCCTATAGA
AGATCCTGATCCTGAGGTTATGGCAAAGGTAAAAGTGCTGTTTGTACGCAACCTTGCCAATACTGTAACA
GAAGAGATTTTAGAAAAGGCATTTAGTCAGTTTGGGAAACTGGAACGAGTGAAGAAGTTAAAAGATTATG
CGTTCATTCATTTTGATGAGCGAGATGGTGCTGTCAAGGCTATGGAAGAAATGAATGGCAAAGACTTGGA
GGGAGAAAATATTGAAATTGTTTTTGCCAAGCCACCAGATCAGAAAAGGAAAGAAAGAAAAGCTCAGAGG
CAAGCAGCAAAAAATCAAATGTATGACGATTACTACTATTATGGTCCACCTCATATGCCCCCTCCAACAA
GAGGTCGAGGGCGTGGAGGTAGAGGTGGTTATGGATATCCTCCAGATTATTATGGATATGAAGATTATTA
TGATTATTATGGTTATGATTACCATAACTATCGTGGTGGATATGAAGATCCATACTATGGTTATGAAGAT
TTTCAAGTTGGAGCTAGAGGAAGGGGTGGTAGAGGAGCAAGGGGTGCTGCTCCATCCAGAGGTCGTGGGG
CTGCTCCTCCCCGCGGTAGAGCCGGTTATTCACAGAGAGGAGGTCCTGGATCAGCAAGAGGCGTTCGAGG
TGCGAGAGGAGGTGCCCAACAACAAAGAGGCCGCGGGGTACGTGGTGCGAGGGGTGGCCGCGGTGGAAAT
GTAGGAGGAAAGCGCAAAGCTGATGGGTACAACCAGCCAGATTCCAAGCGGCGCCAGACCAATAATCAGA
ACTGGGGCTCCCAACCCATTGCTCAGCAACCGCTCCAAGGTGGTGATCATTCTGGTAACTATGGTTACAA
ATCTGAAAACCAGGAGTTTTATCAGGATACTTTTGGGCAACAGTGGAAG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC217902 representing NM_006372
Red=Cloning site Green=Tags(s)

MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAGLVAHSDLDERAIEALKEFNE
DGALAVLQQFKDSDLSHVQNKSAFLCGVMKTYRQREKQGTKVADSSKGPDEAKIKALLERTGYTLDVTTG
QRKYGGPPPDSVYSGQQPSVGTEIFVGKIPRDLFEDELVPLFEKAGPIWDLRLMMDPLTGLNRGYAFVTF
CTKEAAQEAVKLYNNHEIRSGKHIGVCISVANNRLFVGSIPKSKTKEQILEEFSKVTEGLTDVILYHQPD
DKKKNRGFCFLEYEDHKTAAQARRRLMSGKVKVWGNVGTVEWADPIEDPDPEVMAKVKVLFVRNLANTVT
EEILEKAFSQFGKLERVKKLKDYAFIHFDERDGAVKAMEEMNGKDLEGENIEIVFAKPPDQKRKERKAQR
QAAKNQMYDDYYYYGPPHMPPPTRGRGRGGRGGYGYPPDYYGYEDYYDYYGYDYHNYRGGYEDPYYGYED
FQVGARGRGGRGARGAAPSRGRGAAPPRGRAGYSQRGGPGSARGVRGARGGAQQQRGRGVRGARGGRGGN
VGGKRKADGYNQPDSKRRQTNNQNWGSQPIAQQPLQGGDHSGNYGYKSENQEFYQDTFGQQWK

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006372
ORF Size 1869 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006372.5
RefSeq Size 2932 bp
RefSeq ORF 1872 bp
Locus ID 10492
UniProt ID O60506
Cytogenetics 6q14.3
Domains RRM
Protein Families Stem cell - Pluripotency
MW 69.4 kDa
Gene Summary This gene encodes a member of the cellular heterogeneous nuclear ribonucleoprotein (hnRNP) family. hnRNPs are RNA binding proteins that complex with heterogeneous nuclear RNA (hnRNA) and regulate alternative splicing, polyadenylation, and other aspects of mRNA metabolism and transport. The encoded protein plays a role in multiple aspects of mRNA maturation and is associated with several multiprotein complexes including the apoB RNA editing-complex and survival of motor neurons (SMN) complex. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 20. [provided by RefSeq, Dec 2011]
Other products for "SYNCRIP"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.