RAB27A (NM_183234) Human Tagged ORF Clone

CAT#: RC217900

RAB27A (Myc-DDK-tagged)-Human RAB27A, member RAS oncogene family (RAB27A), transcript variant 2

Clone Modification / Custom Cloning Service

USD 402.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name RAB27A (NM_183234) Human Tagged ORF Clone
Symbol RAB27A
Synonyms GS2; HsT18676; RAB27; RAM
Vector pCMV6-Entry
Sequence Data
>RC217900 representing NM_183234
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGATGGAGATTATGATTACCTCATCAAGTTTTTAGCTTTGGGAGACTCTGGTGTAGGGAAGACCA
GTGTACTTTACCAATATACAGATGGTAAATTTAACTCCAAATTTATCACAACAGTGGGCATTGATTTCAG
GGAAAAAAGAGTGGTGTACAGAGCCAGTGGGCCGGATGGAGCCACTGGCAGAGGCCAGAGAATCCACCTG
CAGTTATGGGACACAGCAGGGCAGGAGAGGTTTCGTAGCTTAACGACAGCGTTCTTCAGAGATGCTATGG
GTTTTCTTCTACTTTTTGATCTGACAAATGAGCAAAGTTTCCTCAATGTCAGAAACTGGATAAGCCAGCT
ACAGATGCATGCATATTGTGAAAACCCAGATATAGTGCTGTGTGGAAACAAGAGTGATCTGGAGGACCAG
AGAGTAGTGAAAGAGGAGGAAGCCATAGCACTCGCAGAGAAATATGGAATCCCCTACTTTGAAACTAGTG
CTGCCAATGGGACAAACATAAGCCAAGCAATTGAGATGCTTCTGGACCTGATAATGAAGCGAATGGAACG
GTGTGTGGACAAGTCCTGGATTCCTGAAGGAGTGGTGCGATCAAATGGTCATGCCTCTACGGATCAGTTA
AGTGAAGAAAAGGAGAAAGGGGCATGTGGCTGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217900 representing NM_183234
Red=Cloning site Green=Tags(s)

MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHL
QLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQ
RVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQL
SEEKEKGACGC

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_183234
ORF Size 663 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_183234.1, NM_183234.2, NP_899057
RefSeq Size 2812
RefSeq ORF 666
Locus ID 5873
Cytogenetics 15q21.3
Protein Families Druggable Genome
MW 24.7 kDa
Gene Summary The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscelli syndrome type 2. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)