COQ6 (NM_182480) Human Tagged ORF Clone

CAT#: RC217898

Reviews ()
Write a review

COQ6 (Myc-DDK-tagged)-Human coenzyme Q6 homolog, monooxygenase (S. cerevisiae) (COQ6), nuclear gene encoding mitochondrial protein, transcript variant 2



  "NM_182480" in other vectors (4)

USD 433.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name COQ6 (NM_182480) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol COQ6
Synonyms CGI-10; CGI10; COQ10D6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC217898 representing NM_182480
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGGGCCAGGGTCCACCCCTTTCTAGCTTTGGCGTCTGGTTGGCTTCCAGGGCAGCCTCCGATCCAT
CCCGCCCGAGGAGGCAAGGATATGATATTCACTTTCATGACAAGAAAATCCTGTTGCTCGAAGCAGGTCC
AAAGAAAGTACTGGAGAAATTGTCAGAAACTTACAGCAACAGGGTCAGCTCCATTTCCCCTGGCTCTGCA
ACGCTTCTCAGTAGTTTTGGTGCCTGGGACCATATCTGCAACATGAGATACAGAGCCTTTCGGCGAATGC
AGGTGTGGGACGCCTGCTCAGAGGCCCTGATAATGTTTGATAAGGATAATTTAGATGACATGGGCTATAT
CGTGGAGAATGATGTCATCATGCATGCTCTCACTAAGCAGTTGGAGGCTGTGTCTGACCGAGTGACGGTT
CTCTACAGGAGCAAAGCCATTCGCTATACCTGGCCTTGTCCATTTCCTATGGCCGACTCCAGCCCTTGGG
TTCATATTACCCTAGGTGATGGCAGCACCTTCCAGACCAAATTGTTGATAGGTGCAGATGGTCACAACTC
CGGAGTACGGCAGGCTGTTGGAATCCAGAATGTGAGCTGGAACTATGACCAGTCTGCTGTTGTGGCTACT
CTGCATTTATCAGAGGCCACAGAAAACAACGTAGCCTGGCAGAGATTTCTTCCCTCTGGGCCTATTGCTC
TGCTCCCGCTCTCAGACACCTTGAGTTCCTTGGTTTGGTCCACGTCCCATGAACATGCAGCAGAGCTAGT
TAGCATGGATGAGGAAAAATTTGTGGATGCCGTTAACTCTGCCTTTTGGAGTGATGCTGACCACACGGAC
TTCATCGACACAGCTGGTGCCATGCTGCAGTATGCTGTCAGCCTTCTGAAGCCCACTAAGGTCTCGGCTC
GCCAGCTGCCCCCAAGCGTAGCCAGGGTGGATGCCAAAAGCCGAGTTCTGTTTCCTCTTGGGTTGGGACA
TGCTGCTGAGTACGTCAGGCCTCGGGTGGCGCTCATTGGGGATGCAGCCCACAGAGTCCATCCGCTTGCA
GGACAGGGTGTCAACATGGGCTTTGGGGATATCTCCAGCTTGGCCCATCACCTCAGTACGGCAGCCTTCA
ATGGGAAGGACTTAGGTTCCGTGAGCCACCTCACAGGTTATGAAACAGAAAGACAGCGTCACAACACTGC
TCTTCTGGCTGCTACAGACTTACTAAAAAGGCTCTATTCTACCAGTGCCTCCCCGCTTGTGTTGCTCAGG
ACGTGGGGCTTGCAGGCCACAAATGCAGTGTCTCCACTCAAAGAACAGATTATGGCCTTTGCAAGCAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217898 representing NM_182480
Red=Cloning site Green=Tags(s)

MRGQGPPLSSFGVWLASRAASDPSRPRRQGYDIHFHDKKILLLEAGPKKVLEKLSETYSNRVSSISPGSA
TLLSSFGAWDHICNMRYRAFRRMQVWDACSEALIMFDKDNLDDMGYIVENDVIMHALTKQLEAVSDRVTV
LYRSKAIRYTWPCPFPMADSSPWVHITLGDGSTFQTKLLIGADGHNSGVRQAVGIQNVSWNYDQSAVVAT
LHLSEATENNVAWQRFLPSGPIALLPLSDTLSSLVWSTSHEHAAELVSMDEEKFVDAVNSAFWSDADHTD
FIDTAGAMLQYAVSLLKPTKVSARQLPPSVARVDAKSRVLFPLGLGHAAEYVRPRVALIGDAAHRVHPLA
GQGVNMGFGDISSLAHHLSTAAFNGKDLGSVSHLTGYETERQRHNTALLAATDLLKRLYSTSASPLVLLR
TWGLQATNAVSPLKEQIMAFASK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_182480
ORF Size 1329 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_182480.2, NP_872286.2
RefSeq Size 1553 bp
RefSeq ORF 1332 bp
Locus ID 51004
Cytogenetics 14q24.3
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Ubiquinone and other terpenoid-quinone biosynthesis
MW 43 kDa
Gene Summary The protein encoded by this gene belongs to the ubiH/COQ6 family. It is an evolutionarily conserved monooxygenase required for the biosynthesis of coenzyme Q10 (or ubiquinone), which is an essential component of the mitochondrial electron transport chain, and one of the most potent lipophilic antioxidants implicated in the protection of cell damage by reactive oxygen species. Knockdown of this gene in mouse and zebrafish results in decreased growth due to increased apoptosis. Mutations in this gene are associated with autosomal recessive coenzyme Q10 deficiency-6 (COQ10D6), which manifests as nephrotic syndrome with sensorineural deafness. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jun 2012]

Other Versions

Other products for "COQ6"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 350.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-COQ6 Antibody
    • 100 ul

USD 360.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools