C19orf2 (URI1) (NM_003796) Human Tagged ORF Clone

CAT#: RC217842

Reviews ()
Write a review

URI1 (Myc-DDK-tagged)-Human chromosome 19 open reading frame 2 (C19orf2), transcript variant 1



Reconstitution Protocol

USD 498.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "URI1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol URI1
Synonyms C19orf2; NNX3; PPP1R19; RMP; URI
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC217842 representing NM_003796
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCGCCCACCGTGGAGACGCCCCCCGACCCCTCGCCCCCTTCGGCCCCGGCCCCTGCCCTGGTTC
CGTTGCGCGCCCCGGATGTGGCGCGGCTGCGCGAGGAGCAGGAAAAGGTGGTCACTAACTGCCAAGAGAG
AATCCAGCATTGGAAGAAGGTAGATAATGACTATAATGCCCTTCGAGAAAGACTCAGCACCTTGCCTGAT
AAATTGTCTTATAATATAATGGTACCATTTGGCCCTTTTGCCTTCATGCCAGGAAAACTTGTCCATACTA
ATGAAGTCACTGTTTTACTGGGGGACAACTGGTTTGCAAAGTGCTCAGCAAAGCAGGCTGTAGGTTTAGT
TGAGCACCGGAAAGAACATGTAAGAAAAACAATAGATGACTTAAAAAAAGTGATGAAAAATTTTGAATCC
AGAGTTGAATTCACAGAAGATTTGCAGAAAATGAGCGATGCTGCAGGTGATATTGTTGACATACGAGAAG
AAATTAAATGTGACTTCGAATTTAAAGCAAAACACCGAATTGCTCATAAACCGCATTCCAAACCAAAAAC
TTCAGATATTTTTGAAGCAGATATTGCAAATGATGTGAAATCCAAGGATTTGCTAGCTGATAAAGAACTG
TGGGCTCGACTTGAAGAACTAGAGAGACAGGAAGAATTGCTGGGTGAACTTGATAGTAAGCCTGATACTG
TGATTGCAAATGGAGAAGATACGACATCTTCTGAAGAGGAAAAGGAAGATCGTAACACAAATGTGAATGC
GATGCATCAAGTAACAGACTCTCATACTCCTTGTCATAAGGATGTTGCAAGTTCAGAACCATTCAGTGGT
CAAGTGAATAGTCAGTTGAACTGTTCAGTGAATGGTTCCAGTTCTTACCACAGTGATGATGATGATGATG
ATGATGATGACGACGACGACGACAACATTGACGACGATGATGGTGATAACGACCATGAGGCTTTAGGGGT
TGGAGATAATTCTATACCAACAATATATTTTTCACATACTGTTGAGCCTAAGAGGGTCCGAATAAATACT
GGAAAGAATACCACTTTAAAATTCAGTGAAAAGAAAGAAGAAGCCAAACGTAAACGAAAGAACAGCACTG
GCAGTGGCCACTCTGCCCAGGAGCTGCCGACCATCAGGACGCCTGCAGACATTTACAGAGCCTTTGTTGA
TGTTGTGAATGGAGAATATGTCCCTCGCAAATCCATCCTGAAGTCTCGAAGTAGAGAGAATAGTGTGTGT
AGCGACACTAGTGAAAGCAGTGCTGCTGAATTTGATGATAGGCGGGGAGTTTTGAGGAGTATCAGCTGCG
AAGAAGCCACTTGCAGTGACACCAGTGAGAGCATTTTGGAAGAGGAACCACAAGAAAATCAAAAGAAACT
TTTGCCCTTATCAGTAACACCTGAGGCTTTTTCTGGAACTGTTATAGAAAAAGAATTTGTATCACCTTCC
TTAACACCACCCCCAGCCATTGCTCATCCCGCACTACCCACTATTCCAGAACGAAAGGAAGTTCTGTTGG
AAGCATCTGAAGAAACTGGAAAGAGGGTTTCAAAGTTTAAAGCTGCCAGATTGCAACAGAAAGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217842 representing NM_003796
Red=Cloning site Green=Tags(s)

MEAPTVETPPDPSPPSAPAPALVPLRAPDVARLREEQEKVVTNCQERIQHWKKVDNDYNALRERLSTLPD
KLSYNIMVPFGPFAFMPGKLVHTNEVTVLLGDNWFAKCSAKQAVGLVEHRKEHVRKTIDDLKKVMKNFES
RVEFTEDLQKMSDAAGDIVDIREEIKCDFEFKAKHRIAHKPHSKPKTSDIFEADIANDVKSKDLLADKEL
WARLEELERQEELLGELDSKPDTVIANGEDTTSSEEEKEDRNTNVNAMHQVTDSHTPCHKDVASSEPFSG
QVNSQLNCSVNGSSSYHSDDDDDDDDDDDDDNIDDDDGDNDHEALGVGDNSIPTIYFSHTVEPKRVRINT
GKNTTLKFSEKKEEAKRKRKNSTGSGHSAQELPTIRTPADIYRAFVDVVNGEYVPRKSILKSRSRENSVC
SDTSESSAAEFDDRRGVLRSISCEEATCSDTSESILEEEPQENQKKLLPLSVTPEAFSGTVIEKEFVSPS
LTPPPAIAHPALPTIPERKEVLLEASEETGKRVSKFKAARLQQKD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003796
ORF Size 1605 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003796.3
RefSeq Size 2295 bp
RefSeq ORF 1608 bp
Locus ID 8725
UniProt ID O94763
Cytogenetics 19q12
Domains DUF232
Protein Families Transcription Factors
MW 59.7 kDa
Gene Summary This gene encodes member of the prefoldin family of molecular chaperones. The encoded protein functions as a scaffolding protein and plays roles in ubiquitination and transcription, in part though interactions with the RNA polymerase II subunit RPB5. This gene may play a role in multiple malignancies including ovarian cancer and hepatocellular carcinoma. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 22. [provided by RefSeq, Nov 2011]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.