MIA40 (CHCHD4) (NM_001098502) Human Tagged ORF Clone
CAT#: RC217831
CHCHD4 (Myc-DDK-tagged)-Human coiled-coil-helix-coiled-coil-helix domain containing 4 (CHCHD4), nuclear gene encoding mitochondrial protein, transcript variant 1
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
"NM_001098502" in other vectors (6)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | MIA40 |
Synonyms | MIA40; TIMM40 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC217831 representing NM_001098502
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCCTATTGCCGGCAGGAAGGGAAGGATCGAATCATATTTGTAACCAAAGAAGATCATGAAACTCCAA GCAGTGCAGAATTGGTGGCTGATGACCCCAACGATCCATACGAGGAGCATGGATTGATACTGCCAAATGG AAACATTAACTGGAACTGCCCATGCCTTGGGGGAATGGCCAGCGGTCCCTGTGGAGAACAGTTTAAGTCA GCCTTTTCCTGCTTCCACTATAGCACGGAGGAGATCAAGGGGTCAGACTGTGTAGACCAGTTCCGGGCCA TGCAGGAATGCATGCAGAAATACCCAGACCTCTATCCCCAAGAGGATGAGGATGAGGAAGAGGAAAGAGA GAAGAAGCCAGCAGAACAAGCAGAAGAAACAGCTCCCATTGAGGCCACTGCAACCAAAGAAGAGGAGGGA TCAAGT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC217831 representing NM_001098502
Red=Cloning site Green=Tags(s) MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKS AFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEG SS myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001098502 |
ORF Size | 426 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_001098502.2 |
RefSeq Size | 1476 bp |
RefSeq ORF | 429 bp |
Locus ID | 131474 |
UniProt ID | Q8N4Q1 |
Cytogenetics | 3p25.1 |
MW | 15.8 kDa |
Gene Summary | CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus (Hofmann et al., 2005 [PubMed 16185709]).[supplied by OMIM, Mar 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC217831L1 | Lenti ORF clone of Human coiled-coil-helix-coiled-coil-helix domain containing 4 (CHCHD4), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged |
USD 525.00 |
|
RC217831L2 | Lenti ORF clone of Human coiled-coil-helix-coiled-coil-helix domain containing 4 (CHCHD4), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged |
USD 525.00 |
|
RC217831L3 | Lenti ORF clone of Human coiled-coil-helix-coiled-coil-helix domain containing 4 (CHCHD4), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged |
USD 525.00 |
|
RC217831L4 | Lenti ORF clone of Human coiled-coil-helix-coiled-coil-helix domain containing 4 (CHCHD4), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged |
USD 525.00 |
|
RG217831 | CHCHD4 (tGFP-tagged) - Human coiled-coil-helix-coiled-coil-helix domain containing 4 (CHCHD4), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 425.00 |
|
SC316333 | CHCHD4 (untagged)-Human coiled-coil-helix-coiled-coil-helix domain containing 4 (CHCHD4), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review