KCNC4 (NM_001039574) Human Tagged ORF Clone

CAT#: RC217719

Reviews ()
Write a review
  • TrueORF®

KCNC4 (Myc-DDK-tagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 3


  "NM_001039574" in other vectors (4)

USD 98.00

USD 770.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name KCNC4 (NM_001039574) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KCNC4
Synonyms C1orf30; HKSHIIIC; KSHIIIC; KV3.4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC217719 representing NM_001039574
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCAGCTCGGTGTGTGTCTCCTCCTACCGCGGGCGCAAGTCGGGGAACAAGCCTCCGTCCAAAACAT
GTCTGAAGGAGGAGATGGCCAAGGGCGAGGCGTCGGAGAAGATCATCATCAACGTGGGCGGCACGCGACA
TGAGACCTACCGCAGCACCCTGCGCACCCTACCGGGAACCCGCCTCGCCTGGCTGGCCGACCCCGACGGC
GGGGGCCGGCCCGAGACCGATGGCGGCGGTGTGGGTAGCAGCGGCAGCAGCGGCGGCGGGGGCTGCGAGT
TCTTCTTCGACAGGCACCCGGGCGTCTTCGCCTACGTGCTCAACTACTACCGCACCGGCAAGCTGCACTG
CCCCGCGGACGTGTGCGGGCCGCTCTTCGAAGAGGAGCTCACCTTCTGGGGCATCGACGAGACCGACGTG
GAACCCTGCTGCTGGATGACCTACCGGCAGCACCGCGACGCCGAGGAGGCGCTCGACATCTTCGAGAGCC
CGGACGGAGGCGGCAGCGGCGCGGGGCCCAGCGACGAGGCCGGCGACGATGAGCGGGAGCTGGCCCTGCA
GCGACTGGGCCCCCACGAGGGAGGCGCGGGCCATGGCGCCGGGTCTGGGGGCTGCCGCGGCTGGCAGCCC
CGCATGTGGGCGCTCTTCGAGGATCCCTACTCCTCCCGGGCCGCTAGGGTAGTGGCCTTTGCCTCTCTCT
TCTTCATCCTGGTCTCCATCACCACTTTCTGCCTGGAGACCCATGAGGCCTTTAATATCGACCGCAACGT
GACAGAGATCCTCCGCGTAGGGAACATCACCAGCGTGCACTTCCGGCGGGAGGTAGAGACAGAGCCCATC
CTGACCTACATCGAGGGCGTATGTGTGCTGTGGTTCACACTGGAGTTCCTGGTGCGCATCGTGTGCTGCC
CCGACACGCTGGACTTCGTCAAGAACCTGCTCAACATCATCGACTTTGTGGCCATCCTGCCCTTCTACCT
GGAGGTGGGGCTGAGCGGCCTGTCATCCAAGGCGGCCCGCGACGTGCTGGGCTTCCTGCGCGTGGTGCGC
TTCGTGCGCATCCTGCGTATCTTCAAGCTCACACGCCACTTCGTGGGGCTACGCGTGCTGGGCCACACCC
TGAGGGCCAGCACCAATGAGTTCCTGCTGCTTATCATCTTCCTGGCCCTGGGTGTGCTCATCTTTGCCAC
CATGATCTACTACGCTGAGCGCATTGGGGCCAGGCCCTCCGACCCTCGGGGTAATGACCACACCGACTTC
AAGAACATCCCCATTGGCTTCTGGTGGGCTGTGGTCACCATGACGACACTGGGCTACGGAGACATGTACC
CCAAGACGTGGTCAGGCATGCTGGTAGGGGCACTGTGTGCACTGGCTGGCGTGCTCACCATCGCCATGCC
GGTGCCTGTCATCGTCAACAACTTCGGCATGTACTACTCCCTGGCCATGGCCAAGCAGAAGCTGCCCAAG
AAACGGAAGAAGCACGTGCCACGGCCGGCGCAGCTGGAGTCACCCATGTACTGCAAGTCTGAGGAGACTT
CCCCCCGGGACAGCACCTGCAGTGATACCAGCCCCCCTGCCCGGGAAGAGGGTATGATCGAGAGGAAACG
GGCAGACTCTAAGCAGAATGGCGATGCCAACGCAGTGCTGTCTGATGAGGAGGGAGCTGGCCTCACCCAA
CCCCTGGCCTCCTCCCCGACCCCCGAGGAGCGCCGGGCCCTGCGACGCTCCACCACTCGAGACAGAAACA
AGAAGGCAGCTGCCTGCTTCCTGCTCAGCACTGGGGACTATGCCTGCGCCGATGGTAGTGTCCGGAAAGA
GACCTGCCAAGACGCCCTCTCGTCCAACTATGCCCAGGCTGAAGTCCTCACCCTCTCT


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC217719 representing NM_001039574
Red=Cloning site Green=Tags(s)

MISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGTRLAWLADPDG
GGRPETDGGGVGSSGSSGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDV
EPCCWMTYRQHRDAEEALDIFESPDGGGSGAGPSDEAGDDERELALQRLGPHEGGAGHGAGSGGCRGWQP
RMWALFEDPYSSRAARVVAFASLFFILVSITTFCLETHEAFNIDRNVTEILRVGNITSVHFRREVETEPI
LTYIEGVCVLWFTLEFLVRIVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVR
FVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDF
KNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPK
KRKKHVPRPAQLESPMYCKSEETSPRDSTCSDTSPPAREEGMIERKRADSKQNGDANAVLSDEEGAGLTQ
PLASSPTPEERRALRRSTTRDRNKKAAACFLLSTGDYACADGSVRKETCQDALSSNYAQAEVLTLS

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001039574
ORF Size 1878 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001039574.1, NM_001039574.2, NP_001034663.1
RefSeq Size 3023
RefSeq ORF 1881
Locus ID 3749
Cytogenetics 1p13.3
Protein Families Druggable Genome, Ion Channels: Potassium, Transmembrane
MW 68.6 kDa
Gene Summary The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes. It generates atypical voltage-dependent transient current that may be important for neuronal excitability. Multiple transcript variants have been found for this gene. [provided by RefSeq, Jul 2010]

Other Versions

Other products for "KCNC4"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-KCNC4 Antibody
    • 100 ul

USD 375.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools