AREB6(ZEB1) (NM_030751) Human Tagged ORF Clone

CAT#: RC217704

ZEB1 (Myc-DDK-tagged)-Human zinc finger E-box binding homeobox 1 (ZEB1), transcript variant 2

Clone Modification / Custom Cloning Service

USD 824.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name AREB6(ZEB1) (NM_030751) Human Tagged ORF Clone
Symbol ZEB1
Synonyms AREB6; BZP; DELTAEF1; FECD6; NIL2A; PPCD3; TCF8; ZFHEP; ZFHX1A
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC217704 representing NM_030751
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGATGGCCCCAGGTGTAAGCGCAGAAAGCAGGCGAACCCGCGGCGCAATAACGTTACAAATTATA
ATACTGTGGTAGAAACAAATTCAGATTCAGATGATGAAGACAAACTGCATATTGTGGAAGAAGAAAGTGT
TACAGATGCAGCTGACTGTGAAGGTGTACCAGAGGATGACCTGCCAACAGACCAGACAGTGTTACCAGGG
AGGAGCAGTGAAAGAGAAGGGAATGCTAAGAACTGCTGGGAGGATGACACAGGAAAGGAAGGGCAAGAAA
TCCTGGGGCCTGAAGCTCAGGCAGATGAAGCAGGATGTACAGTAAAAGATGATGAATGCGAGTCAGATGC
AGAAAATGAGCAAAACCATGATCCTAATGTTGAAGAGTTTCTACAACAACAAGACACTGCTGTCATTTTT
CCTGAGGCACCTGAAGAGGACCAGAGGCAGGGCACACCAGAAGCCAGTGGTCATGATGAAAATGGAACAC
CAGATGCATTTTCACAATTACTCACCTGTCCATATTGTGATAGAGGCTATAAACGCTTTACCTCTCTGAA
AGAACACATTAAATATCGTCATGAAAAGAATGAAGATAACTTTAGTTGCTCCCTGTGCAGTTACACCTTT
GCATACAGAACCCAACTTGAACGTCACATGACATCACATAAATCAGGAAGAGATCAAAGACATGTGACGC
AGTCTGGGTGTAATCGTAAATTCAAATGCACTGAGTGTGGAAAAGCTTTCAAATACAAACATCACCTAAA
AGAGCACTTAAGAATTCACAGTGGAGAGAAGCCATATGAATGCCCAAACTGCAAGAAACGCTTTTCCCAT
TCTGGCTCCTATAGCTCACACATAAGCAGTAAGAAATGTATCAGCTTGATACCTGTGAATGGGCGACCAA
GAACAGGACTCAAGACATCTCAGTGTTCTTCACCGTCTCTTTCAGCATCACCAGGCAGTCCCACACGACC
ACAGATACGGCAAAAGATAGAGAATAAACCCCTTCAAGAACAACTTTCTGTTAACCAAATTAAAACTGAA
CCTGTGGATTATGAATTCAAACCCATAGTGGTTGCTTCAGGAATCAACTGTTCAACCCCTTTACAAAATG
GGGTTTTCACTGGTGGTGGCCCATTACAGGCAACCAGTTCTCCTCAGGGCATGGTGCAAGCTGTTGTTCT
GCCAACAGTTGGTTTGGTGTCTCCCATAAGTATCAATTTAAGTGATATTCAGAATGTACTTAAAGTGGCG
GTAGATGGTAATGTAATAAGGCAAGTGTTGGAGAATAATCAAGCCAATCTTGCATCCAAAGAACAAGAAA
CAATCAATGCTTCACCCATACAACAAGGTGGCCATTCTGTTATTTCAGCCATCAGTCTTCCTTTGGTTGA
TCAAGATGGAACAACCAAAATTATCATCAACTACAGTCTTGAGCAGCCTAGCCAACTTCAAGTTGTTCCT
CAAAATTTAAAAAAAGAAAATCCAGTCGCTACAAACAGTTGTAAAAGTGAAAAGTTACCAGAAGATCTTA
CTGTTAAGTCTGAGAAGGACAAAAGCTTTGAAGGGGGGGTGAATGATAGCACTTGTCTTCTGTGTGATGA
TTGTCCAGGAGATATTAATGCACTTCCAGAATTAAAGCACTATGACCTAAAGCAGCCTACTCAGCCTCCT
CCACTCCCTGCAGCAGAAGCTGAGAAGCCTGAGTCCTCTGTTTCATCAGCTACTGGAGATGGCAATTTGT
CTCCTAGTCAGCCACCTTTAAAGAACCTCTTGTCTCTCCTAAAAGCATATTATGCTTTGAATGCACAACC
AAGTGCAGAAGAGCTCTCAAAAATTGCTGATTCAGTAAACCTACCACTGGATGTAGTAAAAAAGTGGTTT
GAAAAGATGCAAGCTGGACAGATTTCAGTGCAGTCTTCTGAACCATCTTCTCCTGAACCAGGCAAAGTAA
ATATCCCTGCCAAGAACAATGATCAGCCTCAATCTGCAAATGCAAATGAACCCCAGGACAGCACAGTAAA
TCTACAAAGTCCTTTGAAGATGACTAACTCCCCAGTTTTACCAGTGGGATCAACCACCAATGGTTCCAGA
AGTAGTACACCATCCCCATCACCTCTAAACCTTTCCTCATCCAGAAATACACAGGGTTACTTGTACACAG
CTGAGGGTGCACAAGAAGAGCCACAAGTAGAACCTCTTGATCTTTCACTACCAAAGCAACAGGGAGAATT
ATTAGAAAGGTCAACTATCACTAGTGTTTACCAGAACAGTGTTTATTCTGTCCAGGAAGAACCCTTGAAC
TTGTCTTGCGCAAAAAAGGAGCCACAAAAGGACAGTTGTGTTACAGACTCAGAACCAGTTGTAAATGTAA
TCCCACCAAGTGCCAACCCCATAAATATCGCTATACCTACAGTCACTGCCCAGTTACCCACAATCGTGGC
CATTGCTGACCAGAACAGTGTTCCATGCTTAAGAGCGCTAGCTGCCAATAAGCAAACGATTCTGATTCCC
CAGGTGGCATACACCTACTCAACTACGGTCAGCCCTGCAGTCCAAGAACCACCCTTGAAAGTGATCCAGC
CAAATGGAAATCAGGATGAAAGACAAGATACTAGCTCAGAAGGAGTATCAAATGTAGAGGATCAGAATGA
CTCTGATTCTACACCGCCCAAAAAGAAAATGCGGAAGACAGAAAATGGAATGTATGCTTGTGATTTGTGT
GACAAGATATTCCAAAAGAGTAGTTCATTATTGAGACATAAATATGAACACACAGGTAAAAGACCTCATG
AGTGTGGAATCTGTAAAAAGGCATTTAAACACAAACATCATTTGATTGAACACATGCGATTACATTCTGG
AGAAAAGCCCTATCAATGTGACAAATGTGGAAAGCGCTTCTCACACTCTGGGTCTTATTCTCAACACATG
AATCATCGCTACTCCTACTGTAAGAGAGAAGCGGAAGAACGTGACAGCACAGAGCAGGAAGAGGCAGGGC
CTGAAATCCTCTCGAATGAGCACGTGGGTGCCAGGGCGTCTCCCTCACAGGGCGACTCGGACGAGAGAGA
GAGTTTGACAAGGGAAGAGGATGAAGACAGTGAAAAAGAGGAAGAGGAGGAGGATAAAGAGATGGAAGAA
TTGCAGGAAGAAAAAGAATGTGAAAAACCACAAGGGGATGAGGAAGAGGAGGAGGAGGAGGAAGAAGTGG
AAGAAGAAGAGGTAGAAGAGGCAGAGAATGAGGGAGAAGAAGCAAAAACTGAAGGTCTGATGAAGGATGA
CAGGGCTGAAAGTCAAGCAAGCAGCTTAGGACAAAAAGTAGGCGAGAGTAGTGAGCAAGTGTCTGAAGAA
AAGACAAATGAAGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC217704 representing NM_030751
Red=Cloning site Green=Tags(s)

MADGPRCKRRKQANPRRNNVTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDDLPTDQTVLPG
RSSEREGNAKNCWEDDTGKEGQEILGPEAQADEAGCTVKDDECESDAENEQNHDPNVEEFLQQQDTAVIF
PEAPEEDQRQGTPEASGHDENGTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNEDNFSCSLCSYTF
AYRTQLERHMTSHKSGRDQRHVTQSGCNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSH
SGSYSSHISSKKCISLIPVNGRPRTGLKTSQCSSPSLSASPGSPTRPQIRQKIENKPLQEQLSVNQIKTE
PVDYEFKPIVVASGINCSTPLQNGVFTGGGPLQATSSPQGMVQAVVLPTVGLVSPISINLSDIQNVLKVA
VDGNVIRQVLENNQANLASKEQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVP
QNLKKENPVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPGDINALPELKHYDLKQPTQPP
PLPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWF
EKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSR
SSTPSPSPLNLSSSRNTQGYLYTAEGAQEEPQVEPLDLSLPKQQGELLERSTITSVYQNSVYSVQEEPLN
LSCAKKEPQKDSCVTDSEPVVNVIPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIP
QVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTENGMYACDLC
DKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHM
NHRYSYCKREAEERDSTEQEEAGPEILSNEHVGARASPSQGDSDERESLTREEDEDSEKEEEEEDKEMEE
LQEEKECEKPQGDEEEEEEEEEVEEEEVEEAENEGEEAKTEGLMKDDRAESQASSLGQKVGESSEQVSEE
KTNEA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_030751
ORF Size 3375 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_030751.1, NM_030751.2, NM_030751.3, NM_030751.4, NM_030751.5, NP_110378
RefSeq Size 5998
RefSeq ORF 3375
Locus ID 6935
Cytogenetics 10p11.22
Domains HOX, zf-C2H2
Protein Families Transcription Factors
MW 124.5 kDa
Gene Summary This gene encodes a zinc finger transcription factor. The encoded protein likely plays a role in transcriptional repression of interleukin 2. Mutations in this gene have been associated with posterior polymorphous corneal dystrophy-3 and late-onset Fuchs endothelial corneal dystrophy. Alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Mar 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (3)