DVL1 (NM_004421) Human Tagged ORF Clone

CAT#: RC217691

Reviews ()
Write a review

DVL1 (Myc-DDK-tagged)-Human dishevelled, dsh homolog 1 (Drosophila) (DVL1)



  "NM_004421" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 691.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DVL1
Synonyms DRS2; DVL; DVL1L1; DVL1P1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC217691 representing NM_004421
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGAGACCAAGATTATCTACCACATGGACGAGGAGGAGACGCCGTACCTGGTCAAGCTGCCCGTGG
CCCCCGAGCGCGTCACGCTGGCCGACTTCAAGAACGTGCTCAGCAACCGGCCCGTGCACGCCTACAAATT
CTTCTTTAAGTCCATGGACCAGGACTTCGGGGTGGTGAAGGAGGAGATCTTTGATGACAATGCCAAGCTT
CCCTGCTTCAACGGCCGCGTGGTCTCCTGGCTGGTCCTGGCTGAGGGTGCTCACTCGGATGCGGGGTCCC
AGGGCACGGACAGCCACACAGACCTGCCCCCGCCTCTTGAGCGGACAGGCGGCATCGGGGACTCCCGGCC
CCCCTCCTTCCACCCGAATGTGGCCAGCAGCCGTGACGGGATGGACAACGAGACAGGCACGGAGTCCATG
GTCAGTCACCGGCGGGAGCGTGCCCGACGCCGGAACCGCGAGGAGGCCGCCCGGACCAATGGGCACCCAA
GGGGAGACCGACGGCGGGATGTGGGGCTGCCCCCAGACAGCGCGTCCACCGCCCTCAGCAGCGAGCTTGA
GTCCAGCAGCTTTGTGGACTCGGACGAGGATGGCAGCACGAGCAGGCTCAGCAGCTCCACGGAGCAGAGC
ACCTCATCCAGACTCATCCGGAAGCACAAACGCCGGCGGAGGAAGCAGCGCCTTCGGCAGGCGGACCGGG
CCTCCTCCTTCAGCAGCATAACCGACTCCACCATGTCCCTCAACATCGTCACTGTCACGCTCAACATGGA
AAGACATCACTTTCTGGGCATCAGCATCGTGGGGCAGAGCAACGACCGTGGAGACGGCGGCATCTACATT
GGCTCCATCATGAAGGGCGGGGCTGTGGCCGCTGACGGCCGCATCGAGCCCGGCGACATGTTGCTGCAGG
TGAATGACGTGAACTTTGAGAACATGAGCAATGACGATGCCGTGCGGGTGCTGCGGGAGATCGTTTCCCA
GACGGGGCCCATCAGCCTCACTGTGGCCAAGTGCTGGGACCCAACGCCCCGAAGCTACTTCACCGTCCCA
CGGGCTGACCCGGTGCGGCCCATCGACCCCGCCGCCTGGCTGTCCCACACGGCGGCACTGACAGGAGCCC
TGCCCCGCTACGAGCTGGAAGAGGCGCCGCTGACGGTGAAGAGTGACATGAGCGCCGTCGTCCGGGTCAT
GCAGCTGCCAGACTCGGGACTGGAGATCCGCGACCGCATGTGGCTCAAGATCACCATCGCCAATGCCGTC
ATCGGGGCGGACGTGGTGGACTGGCTGTACACACACGTGGAGGGCTTCAAGGAGCGGCGGGAGGCCCGGA
AGTACGCCAGCAGCTTGCTGAAGCACGGCTTCCTGCGGCACACGGTCAACAAGATCACCTTCTCCGAGCA
GTGCTACTACGTCTTCGGGGATCTCTGCAGCAATCTCGCCACCCTGAACCTCAACAGTGGCTCCAGTGGG
ACTTCGGATCAGGACACGCTGGCCCCGCTGCCCCACCCGGCTGCCCCCTGGCCTCTGGGTCAGGGCTACC
CCTACCAGTACCCGGGACCCCCACCCTGCTTCCCGCCTGCCTACCAGGACCCGGGCTTTAGCTATGGCAG
CGGCAGCACCGGGAGTCAGCAGAGTGAAGGGAGCAAAAGCAGTGGGTCCACCCGGAGCAGCCGCCGGGCC
CCGGGCCGTGAGAAGGAGCGTCGGGCGGCGGGAGCTGGGGGCAGTGGCAGTGAATCGGATCACACGGCAC
CGAGTGGGGTGGGGAGCAGCTGGCGAGAGCGTCCGGCCGGCCAGCTCAGCCGTGGCAGCAGCCCACGCAG
TCAGGCCTCGGCTACCGCCCCGGGGCTCCCCCCGCCCCACCCCACGACCAAGGCCTATACAGTGGTGGGG
GGGCCACCCGGGGGACCCCCTGTCCGGGAGCTGGCTGCCGTCCCCCCGGAATTGACAGGCAGCCGCCAGT
CCTTCCAGAAGGCTATGGGGAACCCCTGCGAGTTCTTCGTGGACATCATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217691 representing NM_004421
Red=Cloning site Green=Tags(s)

MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVKEEIFDDNAKL
PCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSFHPNVASSRDGMDNETGTESM
VSHRRERARRRNREEAARTNGHPRGDRRRDVGLPPDSASTALSSELESSSFVDSDEDGSTSRLSSSTEQS
TSSRLIRKHKRRRRKQRLRQADRASSFSSITDSTMSLNIVTVTLNMERHHFLGISIVGQSNDRGDGGIYI
GSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTVP
RADPVRPIDPAAWLSHTAALTGALPRYELEEAPLTVKSDMSAVVRVMQLPDSGLEIRDRMWLKITIANAV
IGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNKITFSEQCYYVFGDLCSNLATLNLNSGSSG
TSDQDTLAPLPHPAAPWPLGQGYPYQYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRA
PGREKERRAAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPTTKAYTVVG
GPPGGPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004421
ORF Size 2010 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004421.2, NP_004412.2
RefSeq Size 2941 bp
RefSeq ORF 2013 bp
Locus ID 1855
UniProt ID O14640
Cytogenetics 1p36.33
Protein Families Druggable Genome, ES Cell Differentiation/IPS
Protein Pathways Basal cell carcinoma, Colorectal cancer, Melanogenesis, Notch signaling pathway, Pathways in cancer, Wnt signaling pathway
MW 72.7 kDa
Gene Summary DVL1, the human homolog of the Drosophila dishevelled gene (dsh) encodes a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 is a candidate gene for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "DVL1"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


DVL1 rabbit polyclonal antibody
    • 100 ul

USD 380.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.