DAAM1 (NM_014992) Human Tagged ORF Clone

CAT#: RC217675

DAAM1 (Myc-DDK-tagged)-Human dishevelled associated activator of morphogenesis 1 (DAAM1)

Clone Modification / Custom Cloning Service

USD 1,648.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DAAM1 (NM_014992) Human Tagged ORF Clone
Symbol DAAM1
Synonyms FLJ41657; KIAA0666
Vector pCMV6-Entry
Sequence Data
>RC217675 representing NM_014992
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCCAAGAAAGAGAGGTGGACGAGGTATTTCATTCATCTTTTGCTGTTTCCGAAATAATGATCACC
CAGAAATCACGTATCGGCTGCGAAATGATAGCAACTTTGCGCTTCAGACCATGGAACCAGCATTGCCCAT
GCCCCCTGTGGAGGAGCTGGATGTCATGTTCAGTGAACTGGTGGATGAACTGGACCTCACAGACAAACAC
AGAGAAGCCATGTTTGCACTTCCAGCTGAGAAAAAATGGCAAATATACTGTAGCAAGAAAAAGGACCAGG
AAGAAAACAAGGGAGCTACAAGTTGGCCTGAATTCTACATTGATCAGCTCAATTCCATGGCTGCTAGAAA
ATCTCTGCTGGCTTTAGAGAAGGAAGAAGAAGAAGAAAGAAGTAAAACTATAGAGAGTTTAAAGACAGCA
CTGAGGACAAAACCAATGAGGTTTGTAACCAGATTCATCGACTTGGATGGCCTATCATGTATCCTCAACT
TTCTAAAGACCATGGACTACGAGACCTCAGAGTCTCGAATACATACTTCTCTCATTGGCTGTATAAAGGC
GTTAATGAACAACTCTCAAGGCCGGGCTCACGTCCTGGCTCATTCTGAGAGTATTAATGTAATTGCTCAG
AGTCTGAGCACAGAGAACATTAAAACGAAGGTGGCCGTGCTGGAAATCTTGGGCGCCGTGTGCCTGGTTC
CCGGGGGCCACAAGAAGGTTCTGCAGGCCATGCTGCACTACCAGAAGTATGCCAGCGAAAGGACCCGCTT
TCAGACATTAATTAACGACTTGGATAAAAGCACTGGGCGGTATCGAGATGAAGTGAGTCTCAAGACTGCC
ATCATGTCCTTCATTAATGCAGTGCTCAGCCAAGGTGCAGGAGTGGAGAGTTTGGACTTTAGACTTCATC
TTCGCTATGAATTTCTGATGTTAGGAATTCAACCTGTAATAGATAAATTAAGGGAACACGAAAATTCAAC
ATTAGATAGGCATTTAGACTTTTTTGAAATGCTCCGAAATGAAGATGAACTAGAATTTGCCAAAAGATTT
GAACTGGTTCACATAGACACAAAAAGTGCAACTCAGATGTTTGAGCTGACCAGGAAGAGGCTGACACATA
GTGAAGCTTACCCGCATTTCATGTCCATCCTGCACCACTGCCTCCAAATGCCTTACAAGAGGAGTGGCAA
CACTGTTCAGTACTGGCTACTACTAGATAGAATTATACAGCAGATAGTTATCCAGAATGACAAAGGACAG
GACCCTGACTCCACACCTTTGGAAAACTTTAATATTAAGAATGTCGTACGAATGTTGGTTAATGAAAATG
AAGTTAAGCAGTGGAAAGAACAAGCGGAAAAAATGAGAAAAGAGCACAATGAGCTACAGCAGAAACTGGA
AAAGAAAGAACGAGAATGTGATGCTAAGACTCAAGAGAAGGAAGAGATGATGCAGACCTTAAATAAAATG
AAAGAGAAACTTGAAAAGGAGACTACTGAGCATAAGCAAGTCAAGCAGCAGGTGGCGGACCTCACAGCAC
AGCTCCATGAGCTCAGCAGGAGGGCCGTCTGTGCTTCAATCCCAGGTGGACCCTCGCCTGGAGCACCAGG
AGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCCCACCTCTACCAGGTGGG
ATGCTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAG
GGGCAATCATGCCACCTCCTGGTGCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCAC
AAATGCCCTGAAATCCTTCAACTGGTCTAAACTGCCCGAGAACAAACTGGAAGGAACAGTATGGACCGAA
ATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACCTGGAAAGAACCTTCTCTGCCTATCAAA
GACAGCAGGATTTCTTTGTGAACAGTAACTCCAAGCAGAAAGAAGCAGATGCCATTGATGACACTCTGAG
TTCCAAACTTAAAGTTAAAGAGCTTTCGGTGATTGATGGTCGGAGAGCTCAGAATTGCAACATCCTTCTA
TCGAGGTTGAAATTATCCAATGACGAAATCAAACGGGCAATTCTAACAATGGACGAACAGGAAGATCTGC
CCAAGGACATGTTGGAACAGCTCTTGAAATTTGTTCCTGAAAAAAGTGACATTGACCTATTGGAGGAACA
TAAACACGAACTGGATCGGATGGCCAAGGCTGATAGGTTCCTTTTTGAGATGAGCCGAATTAATCACTAT
CAGCAAAGGTTGCAATCGCTGTACTTCAAAAAGAAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTAAAG
TGGAAGCAATTCGTTCTGGCTCAGAAGAGGTGTTTAGGAGTGGTGCCCTCAAGCAGTTGCTGGAGGTGGT
TTTGGCATTTGGAAATTATATGAATAAAGGTCAAAGAGGGAATGCATATGGATTCAAGATATCTAGCCTA
AACAAAATTGCTGACACAAAATCCAGCATCGACAAAAACATTACCCTTTTGCACTATCTCATCACTATTG
TGGAAAATAAGTACCCCAGTGTTCTCAATCTAAATGAAGAATTGCGAGATATTCCTCAAGCTGCGAAAGT
AAACATGACTGAGCTGGACAAAGAAATAAGTACCTTGAGAAGTGGCTTGAAAGCAGTAGAGACAGAGCTG
GAATATCAGAAGTCTCAGCCCCCACAGCCCGGAGATAAGTTTGTGTCTGTTGTCAGCCAGTTCATCACAG
TAGCCAGCTTCAGCTTCTCTGATGTTGAAGACCTTCTAGCAGAAGCTAAAGACCTGTTTACTAAAGCAGT
GAAGCACTTTGGGGAAGAGGCTGGCAAAATACAACCAGATGAGTTCTTTGGCATTTTTGATCAATTTCTT
CAAGCTGTGTCAGAAGCCAAACAAGAAAACGAAAATATGAGAAAGAAAAAGGAGGAAGAAGAACGTCGAG
CTCGCATGGAAGCTCAGCTCAAAGAACAACGTGAAAGGGAACGTAAAATGAGAAAAGCTAAAGAGAATAG
TGAAGAAAGCGGAGAGTTTGATGACCTTGTTTCAGCTTTACGCTCAGGAGAAGTGTTTGACAAAGACCTT
TCTAAATTGAAACGGAATCGCAAACGTATTACCAACCAGATGACTGACAGCAGCAGAGAGAGACCAATCA
CAAAACTTAATTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217675 representing NM_014992
Red=Cloning site Green=Tags(s)

MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKH
REAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQLNSMAARKSLLALEKEEEEERSKTIESLKTA
LRTKPMRFVTRFIDLDGLSCILNFLKTMDYETSESRIHTSLIGCIKALMNNSQGRAHVLAHSESINVIAQ
SLSTENIKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQKYASERTRFQTLINDLDKSTGRYRDEVSLKTA
IMSFINAVLSQGAGVESLDFRLHLRYEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRNEDELEFAKRF
ELVHIDTKSATQMFELTRKRLTHSEAYPHFMSILHHCLQMPYKRSGNTVQYWLLLDRIIQQIVIQNDKGQ
DPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEMMQTLNKM
KEKLEKETTEHKQVKQQVADLTAQLHELSRRAVCASIPGGPSPGAPGGPFPSSVPGSLLPPPPPPPLPGG
MLPPPPPPLPPGGPPPPPGPPPLGAIMPPPGAPMGLALKKKSIPQPTNALKSFNWSKLPENKLEGTVWTE
IDDTKVFKILDLEDLERTFSAYQRQQDFFVNSNSKQKEADAIDDTLSSKLKVKELSVIDGRRAQNCNILL
SRLKLSNDEIKRAILTMDEQEDLPKDMLEQLLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHY
QQRLQSLYFKKKFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNYMNKGQRGNAYGFKISSL
NKIADTKSSIDKNITLLHYLITIVENKYPSVLNLNEELRDIPQAAKVNMTELDKEISTLRSGLKAVETEL
EYQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKDLFTKAVKHFGEEAGKIQPDEFFGIFDQFL
QAVSEAKQENENMRKKKEEEERRARMEAQLKEQRERERKMRKAKENSEESGEFDDLVSALRSGEVFDKDL
SKLKRNRKRITNQMTDSSRERPITKLNF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_014992
ORF Size 3234 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014992.1, NM_014992.2, NP_055807
RefSeq Size 4256
RefSeq ORF 3237
Locus ID 23002
Cytogenetics 14q23.1
Domains FH2
Protein Pathways Wnt signaling pathway
MW 123.3 kDa
Gene Summary Cell motility, adhesion, cytokinesis, and other functions of the cell cortex are mediated by reorganization of the actin cytoskeleton and several formin homology (FH) proteins have been associated with these processes. The protein encoded by this gene contains two FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. A key regulator of cytoskeletal architecture, the small GTPase Rho, is activated during development by Wnt/Fz signaling to control cell polarity and movement. The protein encoded by this gene is thought to function as a scaffolding protein for the Wnt-induced assembly of a disheveled (Dvl)-Rho complex. This protein also promotes the nucleation and elongation of new actin filaments and regulates cell growth through the stabilization of microtubules. Alternative splicing results in multiple transcript variants encoding distinct proteins. [provided by RefSeq, Jul 2012].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)