DAAM1 (NM_014992) Human Tagged ORF Clone

CAT#: RC217675

Reviews ()
Write a review

DAAM1 (Myc-DDK-tagged)-Human dishevelled associated activator of morphogenesis 1 (DAAM1)



  "NM_014992" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,281.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DAAM1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC217675 representing NM_014992
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCCAAGAAAGAGAGGTGGACGAGGTATTTCATTCATCTTTTGCTGTTTCCGAAATAATGATCACC
CAGAAATCACGTATCGGCTGCGAAATGATAGCAACTTTGCGCTTCAGACCATGGAACCAGCATTGCCCAT
GCCCCCTGTGGAGGAGCTGGATGTCATGTTCAGTGAACTGGTGGATGAACTGGACCTCACAGACAAACAC
AGAGAAGCCATGTTTGCACTTCCAGCTGAGAAAAAATGGCAAATATACTGTAGCAAGAAAAAGGACCAGG
AAGAAAACAAGGGAGCTACAAGTTGGCCTGAATTCTACATTGATCAGCTCAATTCCATGGCTGCTAGAAA
ATCTCTGCTGGCTTTAGAGAAGGAAGAAGAAGAAGAAAGAAGTAAAACTATAGAGAGTTTAAAGACAGCA
CTGAGGACAAAACCAATGAGGTTTGTAACCAGATTCATCGACTTGGATGGCCTATCATGTATCCTCAACT
TTCTAAAGACCATGGACTACGAGACCTCAGAGTCTCGAATACATACTTCTCTCATTGGCTGTATAAAGGC
GTTAATGAACAACTCTCAAGGCCGGGCTCACGTCCTGGCTCATTCTGAGAGTATTAATGTAATTGCTCAG
AGTCTGAGCACAGAGAACATTAAAACGAAGGTGGCCGTGCTGGAAATCTTGGGCGCCGTGTGCCTGGTTC
CCGGGGGCCACAAGAAGGTTCTGCAGGCCATGCTGCACTACCAGAAGTATGCCAGCGAAAGGACCCGCTT
TCAGACATTAATTAACGACTTGGATAAAAGCACTGGGCGGTATCGAGATGAAGTGAGTCTCAAGACTGCC
ATCATGTCCTTCATTAATGCAGTGCTCAGCCAAGGTGCAGGAGTGGAGAGTTTGGACTTTAGACTTCATC
TTCGCTATGAATTTCTGATGTTAGGAATTCAACCTGTAATAGATAAATTAAGGGAACACGAAAATTCAAC
ATTAGATAGGCATTTAGACTTTTTTGAAATGCTCCGAAATGAAGATGAACTAGAATTTGCCAAAAGATTT
GAACTGGTTCACATAGACACAAAAAGTGCAACTCAGATGTTTGAGCTGACCAGGAAGAGGCTGACACATA
GTGAAGCTTACCCGCATTTCATGTCCATCCTGCACCACTGCCTCCAAATGCCTTACAAGAGGAGTGGCAA
CACTGTTCAGTACTGGCTACTACTAGATAGAATTATACAGCAGATAGTTATCCAGAATGACAAAGGACAG
GACCCTGACTCCACACCTTTGGAAAACTTTAATATTAAGAATGTCGTACGAATGTTGGTTAATGAAAATG
AAGTTAAGCAGTGGAAAGAACAAGCGGAAAAAATGAGAAAAGAGCACAATGAGCTACAGCAGAAACTGGA
AAAGAAAGAACGAGAATGTGATGCTAAGACTCAAGAGAAGGAAGAGATGATGCAGACCTTAAATAAAATG
AAAGAGAAACTTGAAAAGGAGACTACTGAGCATAAGCAAGTCAAGCAGCAGGTGGCGGACCTCACAGCAC
AGCTCCATGAGCTCAGCAGGAGGGCCGTCTGTGCTTCAATCCCAGGTGGACCCTCGCCTGGAGCACCAGG
AGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCCCACCTCTACCAGGTGGG
ATGCTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAG
GGGCAATCATGCCACCTCCTGGTGCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCAC
AAATGCCCTGAAATCCTTCAACTGGTCTAAACTGCCCGAGAACAAACTGGAAGGAACAGTATGGACCGAA
ATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACCTGGAAAGAACCTTCTCTGCCTATCAAA
GACAGCAGGATTTCTTTGTGAACAGTAACTCCAAGCAGAAAGAAGCAGATGCCATTGATGACACTCTGAG
TTCCAAACTTAAAGTTAAAGAGCTTTCGGTGATTGATGGTCGGAGAGCTCAGAATTGCAACATCCTTCTA
TCGAGGTTGAAATTATCCAATGACGAAATCAAACGGGCAATTCTAACAATGGACGAACAGGAAGATCTGC
CCAAGGACATGTTGGAACAGCTCTTGAAATTTGTTCCTGAAAAAAGTGACATTGACCTATTGGAGGAACA
TAAACACGAACTGGATCGGATGGCCAAGGCTGATAGGTTCCTTTTTGAGATGAGCCGAATTAATCACTAT
CAGCAAAGGTTGCAATCGCTGTACTTCAAAAAGAAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTAAAG
TGGAAGCAATTCGTTCTGGCTCAGAAGAGGTGTTTAGGAGTGGTGCCCTCAAGCAGTTGCTGGAGGTGGT
TTTGGCATTTGGAAATTATATGAATAAAGGTCAAAGAGGGAATGCATATGGATTCAAGATATCTAGCCTA
AACAAAATTGCTGACACAAAATCCAGCATCGACAAAAACATTACCCTTTTGCACTATCTCATCACTATTG
TGGAAAATAAGTACCCCAGTGTTCTCAATCTAAATGAAGAATTGCGAGATATTCCTCAAGCTGCGAAAGT
AAACATGACTGAGCTGGACAAAGAAATAAGTACCTTGAGAAGTGGCTTGAAAGCAGTAGAGACAGAGCTG
GAATATCAGAAGTCTCAGCCCCCACAGCCCGGAGATAAGTTTGTGTCTGTTGTCAGCCAGTTCATCACAG
TAGCCAGCTTCAGCTTCTCTGATGTTGAAGACCTTCTAGCAGAAGCTAAAGACCTGTTTACTAAAGCAGT
GAAGCACTTTGGGGAAGAGGCTGGCAAAATACAACCAGATGAGTTCTTTGGCATTTTTGATCAATTTCTT
CAAGCTGTGTCAGAAGCCAAACAAGAAAACGAAAATATGAGAAAGAAAAAGGAGGAAGAAGAACGTCGAG
CTCGCATGGAAGCTCAGCTCAAAGAACAACGTGAAAGGGAACGTAAAATGAGAAAAGCTAAAGAGAATAG
TGAAGAAAGCGGAGAGTTTGATGACCTTGTTTCAGCTTTACGCTCAGGAGAAGTGTTTGACAAAGACCTT
TCTAAATTGAAACGGAATCGCAAACGTATTACCAACCAGATGACTGACAGCAGCAGAGAGAGACCAATCA
CAAAACTTAATTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217675 representing NM_014992
Red=Cloning site Green=Tags(s)

MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKH
REAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQLNSMAARKSLLALEKEEEEERSKTIESLKTA
LRTKPMRFVTRFIDLDGLSCILNFLKTMDYETSESRIHTSLIGCIKALMNNSQGRAHVLAHSESINVIAQ
SLSTENIKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQKYASERTRFQTLINDLDKSTGRYRDEVSLKTA
IMSFINAVLSQGAGVESLDFRLHLRYEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRNEDELEFAKRF
ELVHIDTKSATQMFELTRKRLTHSEAYPHFMSILHHCLQMPYKRSGNTVQYWLLLDRIIQQIVIQNDKGQ
DPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEMMQTLNKM
KEKLEKETTEHKQVKQQVADLTAQLHELSRRAVCASIPGGPSPGAPGGPFPSSVPGSLLPPPPPPPLPGG
MLPPPPPPLPPGGPPPPPGPPPLGAIMPPPGAPMGLALKKKSIPQPTNALKSFNWSKLPENKLEGTVWTE
IDDTKVFKILDLEDLERTFSAYQRQQDFFVNSNSKQKEADAIDDTLSSKLKVKELSVIDGRRAQNCNILL
SRLKLSNDEIKRAILTMDEQEDLPKDMLEQLLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHY
QQRLQSLYFKKKFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNYMNKGQRGNAYGFKISSL
NKIADTKSSIDKNITLLHYLITIVENKYPSVLNLNEELRDIPQAAKVNMTELDKEISTLRSGLKAVETEL
EYQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKDLFTKAVKHFGEEAGKIQPDEFFGIFDQFL
QAVSEAKQENENMRKKKEEEERRARMEAQLKEQRERERKMRKAKENSEESGEFDDLVSALRSGEVFDKDL
SKLKRNRKRITNQMTDSSRERPITKLNF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014992
ORF Size 3234 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014992.2
RefSeq Size 4256 bp
RefSeq ORF 3237 bp
Locus ID 23002
UniProt ID Q9Y4D1
Cytogenetics 14q23.1
Domains FH2
Protein Pathways Wnt signaling pathway
MW 123.3 kDa
Gene Summary Cell motility, adhesion, cytokinesis, and other functions of the cell cortex are mediated by reorganization of the actin cytoskeleton and several formin homology (FH) proteins have been associated with these processes. The protein encoded by this gene contains two FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. A key regulator of cytoskeletal architecture, the small GTPase Rho, is activated during development by Wnt/Fz signaling to control cell polarity and movement. The protein encoded by this gene is thought to function as a scaffolding protein for the Wnt-induced assembly of a disheveled (Dvl)-Rho complex. This protein also promotes the nucleation and elongation of new actin filaments and regulates cell growth through the stabilization of microtubules. Alternative splicing results in multiple transcript variants encoding distinct proteins. [provided by RefSeq, Jul 2012]

Other Versions

Other products for "DAAM1"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal Anti-DAAM1 Antibody
    • 100 ul

USD 380.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.