ACCN2(ASIC1) (NM_001095) Human Tagged ORF Clone

CAT#: RC217623

ASIC1 (Myc-DDK-tagged)-Human amiloride-sensitive cation channel 2, neuronal (ACCN2), transcript variant 2

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ACCN2(ASIC1) (NM_001095) Human Tagged ORF Clone
Symbol ASIC1
Synonyms ACCN2; ASIC; BNaC2
Vector pCMV6-Entry
Sequence Data
>RC217623 representing NM_001095
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAACTGAAGGCCGAGGAGGAGGAGGTGGGTGGCGTCCAGCCGGTGAGCATCCAGGCCTTCGCCAGCA
GCTCCACACTGCACGGCCTGGCCCACATCTTCTCCTACGAGCGGCTGTCTCTGAAGCGGGCACTGTGGGC
CCTGTGCTTCCTGGGCTCGCTGGCTGTGCTGCTGTGTGTGTGCACGGAGCGTGTGCAGTACTACTTCCAC
TACCACCATGTCACCAAGCTCGACGAGGTGGCTGCCTCTCAGCTTACCTTCCCTGCTGTCACGCTGTGCA
ACCTCAACGAGTTCCGCTTTAGCCAAGTCTCCAAGAATGACCTGTATCATGCTGGGGAGCTGCTGGCCCT
GCTCAACAACAGGTATGAGATACCAGACACACAGATGGCAGATGAAAAGCAGCTGGAGATACTGCAGGAC
AAAGCCAACTTCCGCAGCTTCAAACCCAAACCCTTCAACATGCGTGAGTTCTACGACCGAGCTGGGCACG
ACATTCGAGACATGCTGCTCTCCTGCCACTTCCGGGGGGAGGTCTGCAGCGCTGAAGACTTCAAGGTGGT
CTTCACACGCTATGGAAAGTGCTACACGTTCAACTCGGGCCGAGATGGGCGGCCGCGGCTGAAGACCATG
AAGGGTGGGACGGGCAATGGGCTGGAAATCATGCTGGACATCCAGCAGGACGAGTACCTGCCTGTGTGGG
GGGAGACTGACGAGACGTCCTTCGAAGCAGGCATCAAAGTGCAGATCCATAGTCAGGATGAACCTCCTTT
CATCGACCAGCTGGGCTTTGGCGTGGCCCCAGGCTTCCAGACCTTTGTGGCCTGCCAGGAGCAGCGGCTC
ATCTACCTGCCCCCACCCTGGGGCACCTGCAAAGCTGTTACCATGGACTCGGATTTGGATTTCTTCGACT
CCTACAGCATCACTGCCTGCCGCATCGACTGTGAGACGCGCTACCTGGTGGAGAACTGCAACTGCCGCAT
GGTGCACATGCCAGGGGATGCCCCATACTGTACTCCAGAGCAGTACAAGGAGTGTGCAGATCCTGCTCTG
GACTTCCTGGTGGAGAAGGACCAGGAGTACTGCGTGTGTGAAATGCCTTGCAACCTGACCCGCTATGGCA
AAGAGCTGTCCATGGTCAAGATCCCCAGCAAAGCCTCAGCCAAGTACCTGGCCAAGAAGTTCAACAAATC
TGAGCAATACATAGGGGAGAACATCCTGGTGCTGGACATTTTCTTTGAAGTCCTCAACTATGAGACCATT
GAACAGAAGAAGGCCTATGAGATTGCAGGGCTCCTGGGTGACATCGGGGGCCAGATGGGGCTGTTCATCG
GGGCCAGCATCCTCACGGTGCTGGAGCTCTTTGACTACGCCTACGAGGTCATTAAGCACAAGCTGTGCCG
ACGAGGAAAATGCCAGAAGGAGGCCAAAAGGAGCAGTGCGGACAAGGGCGTGGCCCTCAGCCTGGACGAC
GTCAAAAGACACAACCCGTGCGAGAGCCTTCGGGGCCACCCTGCCGGGATGACATACGCTGCCAACATCC
TACCTCACCATCCGGCCCGAGGCACGTTCGAGGACTTTACCTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217623 representing NM_001095
Red=Cloning site Green=Tags(s)

MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCVCTERVQYYFH
YHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNNRYEIPDTQMADEKQLEILQD
KANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCSAEDFKVVFTRYGKCYTFNSGRDGRPRLKTM
KGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRL
IYLPPPWGTCKAVTMDSDLDFFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPAL
DFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETI
EQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDD
VKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001095
ORF Size 1584 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001095.1, NM_001095.2, NM_001095.3, NP_001086
RefSeq Size 3785
RefSeq ORF 1587
Locus ID 41
Cytogenetics 12q13.12
Domains ASC
Protein Families Ion Channels: Other, Druggable Genome
MW 59.7 kDa
Gene Summary This gene encodes a member of the acid-sensing ion channel (ASIC) family of proteins, which are part of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. Members of the ASIC family are sensitive to amiloride and function in neurotransmission. The encoded proteins function in learning, pain transduction, touch sensation, and development of memory and fear. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2012].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)