DDX58 (NM_014314) Human Tagged ORF Clone

CAT#: RC217615

DDX58 (Myc-DDK-tagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58)

Clone Modification / Custom Cloning Service

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DDX58 (NM_014314) Human Tagged ORF Clone
Symbol DDX58
Synonyms RIG-I; RIGI; RLR-1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC217615 representing NM_014314
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCACCGAGCAGCGACGCAGCCTGCAAGCCTTCCAGGATTATATCCGGAAGACCCTGGACCCTACCT
ACATCCTGAGCTACATGGCCCCCTGGTTTAGGGAGGAAGAGGTGCAGTATATTCAGGCTGAGAAAAACAA
CAAGGGCCCAATGGAGGCTGCCACACTTTTTCTCAAGTTCCTGTTGGAGCTCCAGGAGGAAGGCTGGTTC
CGTGGCTTTTTGGATGCCCTAGACCATGCAGGTTATTCTGGACTTTATGAAGCCATTGAAAGTTGGGATT
TCAAAAAAATTGAAAAGTTGGAGGAGTATAGATTACTTTTAAAACGTTTACAACCAGAATTTAAAACCAG
AATTATCCCAACCGATATCATTTCTGATCTGTCTGAATGTTTAATTAATCAGGAATGTGAAGAAATTCTA
CAGATTTGCTCTACTAAGGGGATGATGGCAGGTGCAGAGAAATTGGTGGAATGCCTTCTCAGATCAGACA
AGGAAAACTGGCCCAAAACTTTGAAACTTGCTTTGGAGAAAGAAAGGAACAAGTTCAGTGAACTGTGGAT
TGTAGAGAAAGGTATAAAAGATGTTGAAACAGAAGATCTTGAGGATAAGATGGAAACTTCTGACATACAG
ATTTTCTACCAAGAAGATCCAGAATGCCAGAATCTTAGTGAGAATTCATGTCCACCTTCAGAAGTGTCTG
ATACAAACTTGTACAGCCCATTTAAACCAAGAAATTACCAATTAGAGCTTGCTTTGCCTGCTATGAAAGG
AAAAAACACAATAATATGTGCTCCTACAGGTTGTGGAAAAACCTTTGTTTCACTGCTTATATGTGAACAT
CATCTTAAAAAATTCCCACAAGGACAAAAGGGGAAAGTTGTCTTTTTTGCGAATCAGATCCCAGTGTATG
AACAGCAGAAATCTGTATTCTCAAAATACTTTGAAAGACATGGGTATAGAGTTACAGGCATTTCTGGAGC
AACAGCTGAGAATGTCCCAGTGGAACAGATTGTTGAGAACAATGACATCATCATTTTAACTCCACAGATT
CTTGTGAACAACCTTAAAAAGGGAACGATTCCATCACTATCCATCTTTACTTTGATGATATTTGATGAAT
GCCACAACACTAGTAAACAACACCCGTACAATATGATCATGTTTAATTATCTAGATCAGAAACTTGGAGG
ATCTTCAGGCCCACTGCCCCAGGTCATTGGGCTGACTGCCTCGGTTGGTGTTGGGGATGCCAAAAACACA
GATGAAGCCTTGGATTATATCTGCAAGCTGTGTGCTTCTCTTGATGCGTCAGTGATAGCAACAGTCAAAC
ACAATCTGGAGGAACTGGAGCAAGTTGTTTATAAGCCCCAGAAGTTTTTCAGGAAAGTGGAATCACGGAT
TAGCGACAAATTTAAATACATCATAGCTCAGCTGATGAGGGACACAGAGAGTCTGGCAAAGAGAATCTGC
AAAGACCTCGAAAACTTATCTCAAATTCAAAATAGGGAATTTGGAACACAGAAATATGAACAATGGATTG
TTACAGTTCAGAAAGCATGCATGGTGTTCCAGATGCCAGACAAAGATGAAGAGAGCAGGATTTGTAAAGC
CCTGTTTTTATACACTTCACATTTGCGGAAATATAATGATGCCCTCATTATCAGTGAGCATGCACGAATG
AAAGATGCTCTGGATTACTTGAAAGACTTCTTCAGCAATGTCCGAGCAGCAGGATTCGATGAGATTGAGC
AAGATCTTACTCAGAGATTTGAAGAAAAGCTGCAGGAACTAGAAAGTGTTTCCAGGGATCCCAGCAATGA
GAATCCTAAACTTGAAGACCTCTGCTTCATCTTACAAGAAGAGTACCACTTAAACCCAGAGACAATAACA
ATTCTCTTTGTGAAAACCAGAGCACTTGTGGACGCTTTAAAAAATTGGATTGAAGGAAATCCTAAACTCA
GTTTTCTAAAACCTGGCATATTGACTGGACGTGGCAAAACAAATCAGAACACAGGAATGACCCTCCCGGC
ACAGAAGTGTATATTGGATGCATTCAAAGCCAGTGGAGATCACAATATTCTGATTGCCACCTCAGTTGCT
GATGAAGGCATTGACATTGCACAGTGCAATCTTGTCATCCTTTATGAGTATGTGGGCAATGTCATCAAAA
TGATCCAAACCAGAGGCAGAGGAAGAGCAAGAGGTAGCAAGTGCTTCCTTCTGACTAGTAATGCTGGTGT
AATTGAAAAAGAACAAATAAACATGTACAAAGAAAAAATGATGAATGACTCTATTTTACGCCTTCAGACA
TGGGACGAAGCAGTATTTAGGGAAAAGATTCTGCACATACAGACTCATGAAAAATTCATCAGAGATAGTC
AAGAAAAACCAAAACCTGTACCTGATAAGGAAAATAAAAAACTGCTCTGCAGAAAGTGCAAAGCCTTGGC
ATGTTACACAGCTGACGTAAGAGTGATAGAGGAATGCCATTACACTGTGCTTGGAGATGCTTTTAAGGAA
TGCTTTGTGAGTAGACCACATCCCAAGCCAAAGCAGTTTTCAAGTTTTGAAAAAAGAGCAAAGATATTCT
GTGCCCGACAGAACTGCAGCCATGACTGGGGAATCCATGTGAAGTACAAGACATTTGAGATTCCAGTTAT
AAAAATTGAAAGTTTTGTGGTGGAGGATATTGCAACTGGAGTTCAGACACTGTACTCGAAGTGGAAGGAC
TTTCATTTTGAGAAGATACCATTTGATCCAGCAGAAATGTCCAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC217615 representing NM_014314
Red=Cloning site Green=Tags(s)

MTTEQRRSLQAFQDYIRKTLDPTYILSYMAPWFREEEVQYIQAEKNNKGPMEAATLFLKFLLELQEEGWF
RGFLDALDHAGYSGLYEAIESWDFKKIEKLEEYRLLLKRLQPEFKTRIIPTDIISDLSECLINQECEEIL
QICSTKGMMAGAEKLVECLLRSDKENWPKTLKLALEKERNKFSELWIVEKGIKDVETEDLEDKMETSDIQ
IFYQEDPECQNLSENSCPPSEVSDTNLYSPFKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEH
HLKKFPQGQKGKVVFFANQIPVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQI
LVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNT
DEALDYICKLCASLDASVIATVKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRIC
KDLENLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARM
KDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETIT
ILFVKTRALVDALKNWIEGNPKLSFLKPGILTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVA
DEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQT
WDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKE
CFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKD
FHFEKIPFDPAEMSK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_014314
ORF Size 2775 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014314.1, NM_014314.2, NM_014314.3, NP_055129
RefSeq Size 4372
RefSeq ORF 2778
Locus ID 23586
Cytogenetics 9p21.1
Domains DEAD, helicase_C
Protein Pathways RIG-I-like receptor signaling pathway, Cytosolic DNA-sensing pathway
MW 106.4 kDa
Gene Summary DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular processes involving RNA binding and alteration of RNA secondary structure. This gene encodes a protein containing RNA helicase-DEAD box protein motifs and a caspase recruitment domain (CARD). It is involved in viral double-stranded (ds) RNA recognition and the regulation of immune response. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)