DDX58 (NM_014314) Human Tagged ORF Clone

CAT#: RC217615

Reviews ()
Write a review
  • TrueORF®

DDX58 (Myc-DDK-tagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58)



Reconstitution Protocol

USD 1,270.00

3 Weeks*

Size
    • 10 ug

Product images

Other products for "DDX58"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DDX58
Synonyms RIG-I; RIG1; RIGI; RLR-1; SGMRT2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC217615 representing NM_014314
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCACCGAGCAGCGACGCAGCCTGCAAGCCTTCCAGGATTATATCCGGAAGACCCTGGACCCTACCT
ACATCCTGAGCTACATGGCCCCCTGGTTTAGGGAGGAAGAGGTGCAGTATATTCAGGCTGAGAAAAACAA
CAAGGGCCCAATGGAGGCTGCCACACTTTTTCTCAAGTTCCTGTTGGAGCTCCAGGAGGAAGGCTGGTTC
CGTGGCTTTTTGGATGCCCTAGACCATGCAGGTTATTCTGGACTTTATGAAGCCATTGAAAGTTGGGATT
TCAAAAAAATTGAAAAGTTGGAGGAGTATAGATTACTTTTAAAACGTTTACAACCAGAATTTAAAACCAG
AATTATCCCAACCGATATCATTTCTGATCTGTCTGAATGTTTAATTAATCAGGAATGTGAAGAAATTCTA
CAGATTTGCTCTACTAAGGGGATGATGGCAGGTGCAGAGAAATTGGTGGAATGCCTTCTCAGATCAGACA
AGGAAAACTGGCCCAAAACTTTGAAACTTGCTTTGGAGAAAGAAAGGAACAAGTTCAGTGAACTGTGGAT
TGTAGAGAAAGGTATAAAAGATGTTGAAACAGAAGATCTTGAGGATAAGATGGAAACTTCTGACATACAG
ATTTTCTACCAAGAAGATCCAGAATGCCAGAATCTTAGTGAGAATTCATGTCCACCTTCAGAAGTGTCTG
ATACAAACTTGTACAGCCCATTTAAACCAAGAAATTACCAATTAGAGCTTGCTTTGCCTGCTATGAAAGG
AAAAAACACAATAATATGTGCTCCTACAGGTTGTGGAAAAACCTTTGTTTCACTGCTTATATGTGAACAT
CATCTTAAAAAATTCCCACAAGGACAAAAGGGGAAAGTTGTCTTTTTTGCGAATCAGATCCCAGTGTATG
AACAGCAGAAATCTGTATTCTCAAAATACTTTGAAAGACATGGGTATAGAGTTACAGGCATTTCTGGAGC
AACAGCTGAGAATGTCCCAGTGGAACAGATTGTTGAGAACAATGACATCATCATTTTAACTCCACAGATT
CTTGTGAACAACCTTAAAAAGGGAACGATTCCATCACTATCCATCTTTACTTTGATGATATTTGATGAAT
GCCACAACACTAGTAAACAACACCCGTACAATATGATCATGTTTAATTATCTAGATCAGAAACTTGGAGG
ATCTTCAGGCCCACTGCCCCAGGTCATTGGGCTGACTGCCTCGGTTGGTGTTGGGGATGCCAAAAACACA
GATGAAGCCTTGGATTATATCTGCAAGCTGTGTGCTTCTCTTGATGCGTCAGTGATAGCAACAGTCAAAC
ACAATCTGGAGGAACTGGAGCAAGTTGTTTATAAGCCCCAGAAGTTTTTCAGGAAAGTGGAATCACGGAT
TAGCGACAAATTTAAATACATCATAGCTCAGCTGATGAGGGACACAGAGAGTCTGGCAAAGAGAATCTGC
AAAGACCTCGAAAACTTATCTCAAATTCAAAATAGGGAATTTGGAACACAGAAATATGAACAATGGATTG
TTACAGTTCAGAAAGCATGCATGGTGTTCCAGATGCCAGACAAAGATGAAGAGAGCAGGATTTGTAAAGC
CCTGTTTTTATACACTTCACATTTGCGGAAATATAATGATGCCCTCATTATCAGTGAGCATGCACGAATG
AAAGATGCTCTGGATTACTTGAAAGACTTCTTCAGCAATGTCCGAGCAGCAGGATTCGATGAGATTGAGC
AAGATCTTACTCAGAGATTTGAAGAAAAGCTGCAGGAACTAGAAAGTGTTTCCAGGGATCCCAGCAATGA
GAATCCTAAACTTGAAGACCTCTGCTTCATCTTACAAGAAGAGTACCACTTAAACCCAGAGACAATAACA
ATTCTCTTTGTGAAAACCAGAGCACTTGTGGACGCTTTAAAAAATTGGATTGAAGGAAATCCTAAACTCA
GTTTTCTAAAACCTGGCATATTGACTGGACGTGGCAAAACAAATCAGAACACAGGAATGACCCTCCCGGC
ACAGAAGTGTATATTGGATGCATTCAAAGCCAGTGGAGATCACAATATTCTGATTGCCACCTCAGTTGCT
GATGAAGGCATTGACATTGCACAGTGCAATCTTGTCATCCTTTATGAGTATGTGGGCAATGTCATCAAAA
TGATCCAAACCAGAGGCAGAGGAAGAGCAAGAGGTAGCAAGTGCTTCCTTCTGACTAGTAATGCTGGTGT
AATTGAAAAAGAACAAATAAACATGTACAAAGAAAAAATGATGAATGACTCTATTTTACGCCTTCAGACA
TGGGACGAAGCAGTATTTAGGGAAAAGATTCTGCACATACAGACTCATGAAAAATTCATCAGAGATAGTC
AAGAAAAACCAAAACCTGTACCTGATAAGGAAAATAAAAAACTGCTCTGCAGAAAGTGCAAAGCCTTGGC
ATGTTACACAGCTGACGTAAGAGTGATAGAGGAATGCCATTACACTGTGCTTGGAGATGCTTTTAAGGAA
TGCTTTGTGAGTAGACCACATCCCAAGCCAAAGCAGTTTTCAAGTTTTGAAAAAAGAGCAAAGATATTCT
GTGCCCGACAGAACTGCAGCCATGACTGGGGAATCCATGTGAAGTACAAGACATTTGAGATTCCAGTTAT
AAAAATTGAAAGTTTTGTGGTGGAGGATATTGCAACTGGAGTTCAGACACTGTACTCGAAGTGGAAGGAC
TTTCATTTTGAGAAGATACCATTTGATCCAGCAGAAATGTCCAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217615 representing NM_014314
Red=Cloning site Green=Tags(s)

MTTEQRRSLQAFQDYIRKTLDPTYILSYMAPWFREEEVQYIQAEKNNKGPMEAATLFLKFLLELQEEGWF
RGFLDALDHAGYSGLYEAIESWDFKKIEKLEEYRLLLKRLQPEFKTRIIPTDIISDLSECLINQECEEIL
QICSTKGMMAGAEKLVECLLRSDKENWPKTLKLALEKERNKFSELWIVEKGIKDVETEDLEDKMETSDIQ
IFYQEDPECQNLSENSCPPSEVSDTNLYSPFKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEH
HLKKFPQGQKGKVVFFANQIPVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQI
LVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNT
DEALDYICKLCASLDASVIATVKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRIC
KDLENLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARM
KDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETIT
ILFVKTRALVDALKNWIEGNPKLSFLKPGILTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVA
DEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQT
WDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKE
CFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKD
FHFEKIPFDPAEMSK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014314
ORF Size 2775 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014314.4
RefSeq Size 4372 bp
RefSeq ORF 2778 bp
Locus ID 23586
UniProt ID O95786
Cytogenetics 9p21.1
Domains DEAD, helicase_C
Protein Pathways Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway
MW 106.4 kDa
Gene Summary DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular processes involving RNA binding and alteration of RNA secondary structure. This gene encodes a protein containing RNA helicase-DEAD box protein motifs and a caspase recruitment domain (CARD). It is involved in viral double-stranded (ds) RNA recognition and the regulation of the antiviral innate immune response. Mutations in this gene are associated with Singleton-Merten syndrome 2. [provided by RefSeq, Aug 2020]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.