PRMT4 (CARM1) (NM_199141) Human Tagged ORF Clone

CAT#: RC217483

Reviews ()
Write a review

CARM1 (Myc-DDK-tagged)-Human coactivator-associated arginine methyltransferase 1 (CARM1)



Reconstitution Protocol

USD 854.00

In Stock*

Size
    • 10 ug

Product images

Other products for "CARM1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CARM1
Synonyms PRMT4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC217483 representing NM_199141
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGCGGCGGCGGCGGCGGTGGGGCCGGGCGCGGGAGGCGCGGGGTCGGCGGTCCCGGGCGGCGCGG
GGCCCTGCGCTACCGTGTCGGTGTTCCCCGGCGCCCGCCTCCTCACCATCGGCGACGCGAACGGCGAGAT
CCAGCGGCACGCGGAGCAGCAGGCGCTGCGCCTCGAGGTGCGCGCCGGCCCGGACTCGGCGGGCATCGCC
CTCTACAGCCATGAAGATGTGTGTGTCTTTAAGTGCTCAGTGTCCCGAGAGACAGAGTGCAGCCGTGTGG
GCAAGCAGTCCTTCATCATCACCCTGGGCTGCAACAGCGTCCTCATCCAGTTCGCCACACCCAACGATTT
CTGTTCCTTCTACAACATCCTGAAAACCTGCCGGGGCCACACCCTGGAGCGGTCTGTGTTCAGCGAGCGG
ACGGAGGAGTCTTCTGCCGTGCAGTACTTCCAGTTTTATGGCTACCTGTCCCAGCAGCAGAACATGATGC
AGGACTACGTGCGGACAGGCACCTACCAGCGCGCCATCCTGCAAAACCACACCGACTTCAAGGACAAGAT
CGTTCTTGATGTT:GGCTGTGGCTCTGGGATCCTGTCGTTTTTTGCCGCCCAAGCTGGAGCACGGAAAAT
CTACGCGGTGG:AGGCCAGCACCATGGCCCAGCACGC:TGAGGTCTTGGTGAAGAGTAACAACCTGACGG
ACCGCATCGTGGTCATCCCGGGCAAGGTGGA:GGA:GGTGT:CACT:CCCC:G:AGCAGGTGGACATCAT
CAT:CTCGGAGCCCATGGGCTACATGCTCTTCAACGA:GCGCATGCTGGAGAGCTACCTCCACGCCA:AG
AAGTACCTGAAGCCCAGCGGAAACATGTTTCCTACCATTGGTGACGTCCACCTTGCACCCTTCACGGATG
AACAGCTCTACATGGAGCAGTTCACCAAGGCCAACTTCTGGTACCAGCCATCTTTCCATGGAGTGGACCT
GTCGGCCCTCCGAGGTGCCGCGGTGGATGAGTATTTCCGGCAGCCTGTGGTGGACACATTTGACATCCGG
ATCCTGATGGCCAAGTCTGTCAAGTACACGGTGAACTTCTTAGAAGCCAAAGAAGGAGATTTGCACAGGA
TAGAAATCCCATTCAAATTCCACATGCTGCATTCAGGGCTGGTCCACGGCCTGGCTTTCTGGTTTGACGT
TGCTTTCATCGGCTCCATAATGACCGTGTGGCTGTCCACAGCCCCGACAGAGCCCCTGACCCACTGGTAC
CAGGTGCGGTGCCTGTTCCAGTCACCACTGTTCGCCAAGGCAGGGGACACGCTCTCAGGGACATGTCTGC
TTATTGCCAACAAAAGACAGAGCTACGACATCAGTATTGTGGCCCAGGTGGACCAGACCGGCTCCAAGTC
CAGTAACCTCCTGGATCTGAAAAACCCCTTCTTTAGATACACGGGCACAACGCCCTCACCCCCACCCGGC
TCCCACTACACATCTCCCTCGGAAAACATGTGGAACACGGGCAGCACCTACAACCTCAGCAGCGGGATGG
CCGTGGCAGGGATGCCGACCGCCTATGACTTGAGCAGTGTTATTGCCAGTGGCTCCAGCGTGGGCCATAA
CAACCTGATTCCTTTAGCCAACACGGGGATTGTCAATCACACCCACTCCCGGATGGGCTCCATAATGAGC
ACGGGGATTGTCCAAGGGTCCTCCGGCGCCCAGGGCAGTGGTGGTGGCAGCACGAGTGCCCACTATGCAG
TCAACAGCCAGTTCACCATGGGCGGCCCCGCCATCTCCATGGCGTCGCCCATGTCCATCCCGACCAACAC
CATGCACTACGGGAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217483 representing NM_199141
Red=Cloning site Green=Tags(s)

MAAAAAAVGPGAGGAGSAVPGGAGPCATVSVFPGARLLTIGDANGEIQRHAEQQALRLEVRAGPDSAGIA
LYSHEDVCVFKCSVSRETECSRVGKQSFIITLGCNSVLIQFATPNDFCSFYNILKTCRGHTLERSVFSER
TEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVXLWLWDPVVFCRPSWSTEN
LRGXRPAPWPSTXEVLVKSNNLTDRIVVIPGKVXGXCXXPXXQVDIIXLGAHGLHALQRXACWRATSTPX
KYLKPSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIR
ILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWY
QVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYTGTTPSPPPG
SHYTSPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLANTGIVNHTHSRMGSIMS
TGIVQGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIPTNTMHYGS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_199141
ORF Size 1836 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_199141.1, NP_954592.1
RefSeq Size 2968 bp
RefSeq ORF 1827 bp
Locus ID 10498
UniProt ID Q86X55
Cytogenetics 19p13.2
Protein Families Druggable Genome, Transcription Factors
MW 65.7 kDa
Gene Summary This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts specifically on histones and other chromatin-associated proteins and is involved in regulation of gene expression. The enzyme may act in association with other proteins or within multi-protein complexes and may play a role in cell type-specific functions and cell lineage specification. A related pseudogene is located on chromosome 9. [provided by RefSeq, Aug 2013]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.