FBXW7 (NM_033632) Human Tagged ORF Clone

CAT#: RC217398

Reviews ()
Write a review

FBXW7 (Myc-DDK-tagged)-Human F-box and WD repeat domain containing 7 (FBXW7), transcript variant 1



  "NM_033632" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 971.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "FBXW7"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol FBXW7
Synonyms AGO; CDC4; FBW6; FBW7; FBX30; FBXO30; FBXW6; hAgo; hCdc4; SEL-10; SEL10
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC217398 representing NM_033632
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATCAGGAACTGCTCTCTGTGGGCAGCAAAAGACGACGAACTGGAGGCTCTCTGAGAGGTAACCCTT
CCTCAAGCCAGGTAGATGAAGAACAGATGAATCGTGTGGTAGAGGAGGAACAGCAACAGCAACTCAGACA
ACAAGAGGAGGAGCACACTGCAAGGAATGGTGAAGTTGTTGGAGTAGAACCTAGACCTGGAGGCCAAAAT
GATTCCCAGCAAGGACAGTTGGAAGAAAACAATAATAGATTTATTTCGGTAGATGAGGACTCCTCAGGAA
ACCAAGAAGAACAAGAGGAAGATGAAGAACATGCTGGTGAACAAGATGAGGAGGATGAGGAGGAGGAGGA
GATGGACCAGGAGAGTGACGATTTTGATCAGTCTGATGATAGTAGCAGAGAAGATGAACATACACATACT
AACAGTGTCACGAACTCCAGTAGTATTGTGGACCTGCCCGTTCACCAACTCTCCTCCCCATTCTATACAA
AAACAACAAAAATGAAAAGAAAGTTGGACCATGGTTCTGAGGTCCGCTCTTTTTCTTTGGGAAAGAAACC
ATGCAAAGTCTCAGAATATACAAGTACCACTGGGCTTGTACCATGTTCAGCAACACCAACAACTTTTGGG
GACCTCAGAGCAGCCAATGGCCAAGGGCAACAACGACGCCGAATTACATCTGTCCAGCCACCTACAGGCC
TCCAGGAATGGCTAAAAATGTTTCAGAGCTGGAGTGGACCAGAGAAATTGCTTGCTTTAGATGAACTCAT
TGATAGTTGTGAACCAACACAAGTAAAACATATGATGCAAGTGATAGAACCCCAGTTTCAACGAGACTTC
ATTTCATTGCTCCCTAAAGAGTTGGCACTCTATGTGCTTTCATTCCTGGAACCCAAAGACCTGCTACAAG
CAGCTCAGACATGTCGCTACTGGAGAATTTTGGCTGAAGACAACCTTCTCTGGAGAGAGAAATGCAAAGA
AGAGGGGATTGATGAACCATTGCACATCAAGAGAAGAAAAGTAATAAAACCAGGTTTCATACACAGTCCA
TGGAAAAGTGCATACATCAGACAGCACAGAATTGATACTAACTGGAGGCGAGGAGAACTCAAATCTCCTA
AGGTGCTGAAAGGACATGATGATCATGTGATCACATGCTTACAGTTTTGTGGTAACCGAATAGTTAGTGG
TTCTGATGACAACACTTTAAAAGTTTGGTCAGCAGTCACAGGCAAATGTCTGAGAACATTAGTGGGACAT
ACAGGTGGAGTATGGTCATCACAAATGAGAGACAACATCATCATTAGTGGATCTACAGATCGGACACTCA
AAGTGTGGAATGCAGAGACTGGAGAATGTATACACACCTTATATGGGCATACTTCCACTGTGCGTTGTAT
GCATCTTCATGAAAAAAGAGTTGTTAGCGGTTCTCGAGATGCCACTCTTAGGGTTTGGGATATTGAGACA
GGCCAGTGTTTACATGTTTTGATGGGTCATGTTGCAGCAGTCCGCTGTGTTCAATATGATGGCAGGAGGG
TTGTTAGTGGAGCATATGATTTTATGGTAAAGGTGTGGGATCCAGAGACTGAAACCTGTCTACACACGTT
GCAGGGGCATACTAATAGAGTCTATTCATTACAGTTTGATGGTATCCATGTGGTGAGTGGATCTCTTGAT
ACATCAATCCGTGTTTGGGATGTGGAGACAGGGAATTGCATTCACACGTTAACAGGGCACCAGTCGTTAA
CAAGTGGAATGGAACTCAAAGACAATATTCTTGTCTCTGGGAATGCAGATTCTACAGTTAAAATCTGGGA
TATCAAAACAGGACAGTGTTTACAAACATTGCAAGGTCCCAACAAGCATCAGAGTGCTGTGACCTGTTTA
CAGTTCAACAAGAACTTTGTAATTACCAGCTCAGATGATGGAACTGTAAAACTATGGGACTTGAAAACGG
GTGAATTTATTCGAAACCTAGTCACATTGGAGAGTGGGGGGAGTGGGGGAGTTGTGTGGCGGATCAGAGC
CTCAAACACAAAGCTGGTGTGTGCAGTTGGGAGTCGGAATGGGACTGAAGAAACCAAGCTGCTGGTGCTG
GACTTTGATGTGGACATGAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217398 representing NM_033632
Red=Cloning site Green=Tags(s)

MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVVGVEPRPGGQN
DSQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQESDDFDQSDDSSREDEHTHT
NSVTNSSSIVDLPVHQLSSPFYTKTTKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFG
DLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDF
ISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSP
WKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGH
TGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIET
GQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD
TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCL
QFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVL
DFDVDMK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_033632
ORF Size 2121 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_033632.3
RefSeq Size 3896 bp
RefSeq ORF 2124 bp
Locus ID 55294
UniProt ID Q969H0
Cytogenetics 4q31.3
Domains WD40, F-box
Protein Families Druggable Genome, Transmembrane
Protein Pathways Ubiquitin mediated proteolysis
MW 79.5 kDa
Gene Summary This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene was previously referred to as FBX30, and belongs to the Fbws class; in addition to an F-box, this protein contains 7 tandem WD40 repeats. This protein binds directly to cyclin E and probably targets cyclin E for ubiquitin-mediated degradation. Mutations in this gene are detected in ovarian and breast cancer cell lines, implicating the gene's potential role in the pathogenesis of human cancers. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2012]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.