FBXW7(FBXW7) (NM_033632) Human Tagged ORF Clone

CAT#: RC217398

FBXW7 (Myc-DDK-tagged)-Human F-box and WD repeat domain containing 7 (FBXW7), transcript variant 1

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FBXW7(FBXW7) (NM_033632) Human Tagged ORF Clone
Symbol FBXW7
Synonyms AGO; CDC4; FBW6; FBW7; FBX30; FBXO30; FBXW6; hAgo; hCdc4; SEL-10; SEL10
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC217398 representing NM_033632
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATCAGGAACTGCTCTCTGTGGGCAGCAAAAGACGACGAACTGGAGGCTCTCTGAGAGGTAACCCTT
CCTCAAGCCAGGTAGATGAAGAACAGATGAATCGTGTGGTAGAGGAGGAACAGCAACAGCAACTCAGACA
ACAAGAGGAGGAGCACACTGCAAGGAATGGTGAAGTTGTTGGAGTAGAACCTAGACCTGGAGGCCAAAAT
GATTCCCAGCAAGGACAGTTGGAAGAAAACAATAATAGATTTATTTCGGTAGATGAGGACTCCTCAGGAA
ACCAAGAAGAACAAGAGGAAGATGAAGAACATGCTGGTGAACAAGATGAGGAGGATGAGGAGGAGGAGGA
GATGGACCAGGAGAGTGACGATTTTGATCAGTCTGATGATAGTAGCAGAGAAGATGAACATACACATACT
AACAGTGTCACGAACTCCAGTAGTATTGTGGACCTGCCCGTTCACCAACTCTCCTCCCCATTCTATACAA
AAACAACAAAAATGAAAAGAAAGTTGGACCATGGTTCTGAGGTCCGCTCTTTTTCTTTGGGAAAGAAACC
ATGCAAAGTCTCAGAATATACAAGTACCACTGGGCTTGTACCATGTTCAGCAACACCAACAACTTTTGGG
GACCTCAGAGCAGCCAATGGCCAAGGGCAACAACGACGCCGAATTACATCTGTCCAGCCACCTACAGGCC
TCCAGGAATGGCTAAAAATGTTTCAGAGCTGGAGTGGACCAGAGAAATTGCTTGCTTTAGATGAACTCAT
TGATAGTTGTGAACCAACACAAGTAAAACATATGATGCAAGTGATAGAACCCCAGTTTCAACGAGACTTC
ATTTCATTGCTCCCTAAAGAGTTGGCACTCTATGTGCTTTCATTCCTGGAACCCAAAGACCTGCTACAAG
CAGCTCAGACATGTCGCTACTGGAGAATTTTGGCTGAAGACAACCTTCTCTGGAGAGAGAAATGCAAAGA
AGAGGGGATTGATGAACCATTGCACATCAAGAGAAGAAAAGTAATAAAACCAGGTTTCATACACAGTCCA
TGGAAAAGTGCATACATCAGACAGCACAGAATTGATACTAACTGGAGGCGAGGAGAACTCAAATCTCCTA
AGGTGCTGAAAGGACATGATGATCATGTGATCACATGCTTACAGTTTTGTGGTAACCGAATAGTTAGTGG
TTCTGATGACAACACTTTAAAAGTTTGGTCAGCAGTCACAGGCAAATGTCTGAGAACATTAGTGGGACAT
ACAGGTGGAGTATGGTCATCACAAATGAGAGACAACATCATCATTAGTGGATCTACAGATCGGACACTCA
AAGTGTGGAATGCAGAGACTGGAGAATGTATACACACCTTATATGGGCATACTTCCACTGTGCGTTGTAT
GCATCTTCATGAAAAAAGAGTTGTTAGCGGTTCTCGAGATGCCACTCTTAGGGTTTGGGATATTGAGACA
GGCCAGTGTTTACATGTTTTGATGGGTCATGTTGCAGCAGTCCGCTGTGTTCAATATGATGGCAGGAGGG
TTGTTAGTGGAGCATATGATTTTATGGTAAAGGTGTGGGATCCAGAGACTGAAACCTGTCTACACACGTT
GCAGGGGCATACTAATAGAGTCTATTCATTACAGTTTGATGGTATCCATGTGGTGAGTGGATCTCTTGAT
ACATCAATCCGTGTTTGGGATGTGGAGACAGGGAATTGCATTCACACGTTAACAGGGCACCAGTCGTTAA
CAAGTGGAATGGAACTCAAAGACAATATTCTTGTCTCTGGGAATGCAGATTCTACAGTTAAAATCTGGGA
TATCAAAACAGGACAGTGTTTACAAACATTGCAAGGTCCCAACAAGCATCAGAGTGCTGTGACCTGTTTA
CAGTTCAACAAGAACTTTGTAATTACCAGCTCAGATGATGGAACTGTAAAACTATGGGACTTGAAAACGG
GTGAATTTATTCGAAACCTAGTCACATTGGAGAGTGGGGGGAGTGGGGGAGTTGTGTGGCGGATCAGAGC
CTCAAACACAAAGCTGGTGTGTGCAGTTGGGAGTCGGAATGGGACTGAAGAAACCAAGCTGCTGGTGCTG
GACTTTGATGTGGACATGAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC217398 representing NM_033632
Red=Cloning site Green=Tags(s)

MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVVGVEPRPGGQN
DSQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQESDDFDQSDDSSREDEHTHT
NSVTNSSSIVDLPVHQLSSPFYTKTTKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFG
DLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDF
ISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSP
WKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGH
TGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIET
GQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD
TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCL
QFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVL
DFDVDMK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_033632
ORF Size 2121 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_033632.1, NM_033632.2, NM_033632.3, NP_361014
RefSeq Size 3896
RefSeq ORF 2124
Locus ID 55294
Cytogenetics 4q31.3
Domains WD40, F-box
Protein Families Transmembrane, Druggable Genome
Protein Pathways Ubiquitin mediated proteolysis
MW 79.5 kDa
Gene Summary This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene was previously referred to as FBX30, and belongs to the Fbws class; in addition to an F-box, this protein contains 7 tandem WD40 repeats. This protein binds directly to cyclin E and probably targets cyclin E for ubiquitin-mediated degradation. Mutations in this gene are detected in ovarian and breast cancer cell lines, implicating the gene's potential role in the pathogenesis of human cancers. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2012].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)