DNA2 (NM_001080449) Human Tagged ORF Clone

CAT#: RC217395

DNA2 (Myc-DDK-tagged)-Human DNA replication helicase 2 homolog (yeast) (DNA2)

Clone Modification / Custom Cloning Service

USD 1,751.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DNA2 (NM_001080449) Human Tagged ORF Clone
Symbol DNA2
Synonyms DNA2L; hDNA2
Vector pCMV6-Entry
Sequence Data
>RC217395 representing NM_001080449
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGACTCCCTGTATTCCCAGTCCTAAGCAAGGGAGCAAAGGCAGGGGACAGAGCCCTGCTGCTCAGG
TGAGGGGCCCCACGTGGAACGCGCCGGCGCGGGAGGGGCGGCCTGGCGCAGGTCATTTGGGACATCTGCG
GGTTGGCGCATGCGCGCGAGGTGCGCAGGCTCGCGCCTTTTTCCCTTTTCTAAGCTTTCTGTGTTACCCC
CGGTTCCGCTGTCTTTTCTGTCTACAGTTTGCGATCCCCGCGTCCAGGATGGAGCAGCTGAACGAACTGG
AGCTGCTGATGGAGAAGAGTTTTTGGGAGGAGGCGGAGCTGCCGGCGGAGCTATTTCAGAAGAAAGTGGT
AGCTTCCTTTCCAAGAACAGTTCTGAGCACAGGAATGGATAACCGGTACCTGGTGTTGGCAGTCAATACT
GTACAGAACAAAGAGGGAAACTGTGAAAAGCGCCTGGTCATCACTGCTTCACAGTCACTAGAAAATAAAG
AACTATGCATCCTTAGGAATGACTGGTGTTCTGTTCCAGTAGAGCCAGGAGATATCATTCATTTGGAGGG
AGACTGCACATCTGACACTTGGATAATAGATAAAGATTTTGGATATTTGATTCTGTATCCAGACATGCTG
ATTTCTGGCACCAGCATAGCCAGTAGTATTCGATGTATGAGAAGAGCTGTCCTGAGTGAAACTTTTAGGA
GCTCTGATCCAGCCACACGCCAAATGCTAATTGGTACGGTTCTCCATGAGGTGTTTCAAAAAGCCATAAA
TAATAGCTTTGCCCCAGAAAAGCTACAAGAACTTGCTTTTCAAACAATTCAAGAAATAAGACATTTGAAG
GAAATGTACCGCTTAAATCTAAGTCAAGATGAAATAAAACAAGAAGTAGAGGACTATCTTCCTTCGTTTT
GTAAATGGGCAGGAGATTTCATGCATAAAAACACTTCGACTGACTTCCCTCAGATGCAGCTCTCTCTGCC
AAGTGATAATAGTAAGGATAATTCAACATGTAACATTGAAGTCGTGAAACCAATGGATATTGAAGAAAGC
ATTTGGTCCCCTAGGTTTGGATTGAAAGGCAAAATAGATGTTACAGTTGGTGTGAAAATACATCGAGGGT
ATAAAACAAAATACAAGATAATGCCGCTGGAACTTAAAACTGGCAAAGAATCAAATTCTATTGAACACCG
TAGTCAGGTTGTTCTGTACACTCTACTAAGCCAAGAGAGAAGAGCTGATCCAGAGGCTGGCTTGCTTCTC
TACCTCAAGACTGGTCAGATGTACCCTGTGCCTGCCAACCATCTAGATAAAAGAGAATTATTAAAGCTAA
GAAACCAGATGGCATTCTCATTGTTTCACCGTATTAGCAAATCTGCTACTAGACAGAAGACACAGCTTGC
TTCTTTGCCACAAATAATTGAGGAAGAGAAAACTTGTAAATATTGTTCACAAATTGGCAATTGTGCTCTT
TATAGCAGAGCAGTTGAACAACAGATGGATTGTAGTTCAGTCCCAATTGTGATGCTGCCCAAAATAGAAG
AAGAAACCCAGCATCTGAAGCAAACACACTTAGAATATTTCAGCCTTTGGTGTCTAATGTTAACCCTGGA
GTCACAATCGAAGGATAATAAAAAGAATCACCAAAATATCTGGCTAATGCCTGCTTCGGAAATGGAGAAG
AGTGGCAGTTGCATTGGAAACCTGATTAGAATGGAACATGTAAAGATAGTTTGTGATGGGCAATATTTAC
ATAATTTCCAATGTAAACATGGTGCCATACCTGTCACAAATCTAATGGCAGGTGACAGAGTTATTGTAAG
TGGAGAAGAAAGGTCACTGTTTGCTTTGTCTAGAGGATATGTGAAGGAGATTAACATGACAACAGTAACT
TGTTTATTAGACAGAAACTTGTCGGTCCTTCCAGAATCAACTTTGTTCAGATTAGACCAAGAAGAAAAAA
ATTGTGATATAGATACCCCATTAGGAAATCTTTCCAAATTGATGGAAAACACGTTTGTCAGCAAAAAACT
TCGAGATTTAATTATTGACTTTCGTGAACCTCAGTTTATATCCTACCTTAGTTCTGTTCTTCCACATGAT
GCAAAGGATACAGTTGCCTGCATTCTAAAGGGTTTGAATAAGCCTCAGAGGCAAGCGATGAAAAAGGTAC
TTCTTTCAAAAGACTACACACTCATCGTGGGTATGCCTGGGACAGGAAAAACAACTACGATATGTACTCT
CGTAAGAATTCTCTACGCCTGTGGTTTTAGCGTTTTGTTGACCAGCTATACACACTCTGCTGTTGACAAT
ATTCTTTTGAAGTTAGCCAAGTTTAAAATAGGATTTTTGCGTTTGGGTCAGATTCAGAAGGTTCATCCAG
CTATCCAGCAATTTACAGAGCAAGAAATTTGCAGATCAAAGTCCATTAAATCCTTAGCTCTTCTAGAAGA
ACTCTACAATAGTCAACTTATAGTTGCAACAACATGTATGGGAATAAACCATCCAATATTTTCCCGTAAA
ATTTTTGATTTTTGTATTGTGGATGAAGCCTCTCAAATTAGCCAACCAATTTGTCTGGGCCCCCTTTTTT
TTTCACGGAGATTTGTGTTAGTGGGGGACCATCAGCAGCTTCCTCCCCTGGTGCTAAACCGTGAAGCAAG
AGCTCTTGGCATGAGTGAAAGCTTATTCAAGAGGCTGGAGCAGAATAAGAGTGCTGTTGTACAGTTAACC
GTGCAGTACAGAATGAACAGTAAAATTATGTCCTTAAGTAATAAGCTGACCTATGAGGGCAAGCTGGAGT
GTGGATCAGACAAAGTGGCCAATGCAGTGATAAACCTACGTCACTTTAAAGATGTGAAGCTGGAACTGGA
ATTTTATGCTGACTATTCTGATAATCCTTGGTTGATGGGAGTATTTGAACCCAACAATCCTGTTTGTTTC
CTTAATACAGACAAGGTTCCAGCGCCAGAACAAGTTGAAAAAGGTGGTGTGAGCAATGTAACAGAAGCCA
AACTCATAGTTTTCCTAACCTCCATTTTTGTTAAGGCTGGATGCAGTCCCTCTGATATTGGTATTATTGC
ACCGTACAGGCAGCAATTAAAGATCATCAATGATTTATTGGCACGTTCTATTGGGATGGTCGAAGTTAAT
ACAGTAGACAAATACCAAGGAAGGGACAAAAGTATTGTCCTAGTATCTTTTGTTAGAAGTAATAAGGATG
GAACTGTTGGTGAACTCTTGAAAGATTGGCGACGTCTTAATGTTGCTATAACCAGAGCCAAACATAAACT
GATTCTTCTGGGGTGTGTGCCCTCACTAAATTGCTATCCTCCTTTGGAGAAGCTGCTTAATCATTTAAAC
TCAGAAAAATTAATCATTGATCTTCCATCAAGAGAACATGAAAGTCTTTGCCACATATTGGGTGACTTTC
AAAGAGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217395 representing NM_001080449
Red=Cloning site Green=Tags(s)

MKTPCIPSPKQGSKGRGQSPAAQVRGPTWNAPAREGRPGAGHLGHLRVGACARGAQARAFFPFLSFLCYP
RFRCLFCLQFAIPASRMEQLNELELLMEKSFWEEAELPAELFQKKVVASFPRTVLSTGMDNRYLVLAVNT
VQNKEGNCEKRLVITASQSLENKELCILRNDWCSVPVEPGDIIHLEGDCTSDTWIIDKDFGYLILYPDML
ISGTSIASSIRCMRRAVLSETFRSSDPATRQMLIGTVLHEVFQKAINNSFAPEKLQELAFQTIQEIRHLK
EMYRLNLSQDEIKQEVEDYLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEES
IWSPRFGLKGKIDVTVGVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQVVLYTLLSQERRADPEAGLLL
YLKTGQMYPVPANHLDKRELLKLRNQMAFSLFHRISKSATRQKTQLASLPQIIEEEKTCKYCSQIGNCAL
YSRAVEQQMDCSSVPIVMLPKIEEETQHLKQTHLEYFSLWCLMLTLESQSKDNKKNHQNIWLMPASEMEK
SGSCIGNLIRMEHVKIVCDGQYLHNFQCKHGAIPVTNLMAGDRVIVSGEERSLFALSRGYVKEINMTTVT
CLLDRNLSVLPESTLFRLDQEEKNCDIDTPLGNLSKLMENTFVSKKLRDLIIDFREPQFISYLSSVLPHD
AKDTVACILKGLNKPQRQAMKKVLLSKDYTLIVGMPGTGKTTTICTLVRILYACGFSVLLTSYTHSAVDN
ILLKLAKFKIGFLRLGQIQKVHPAIQQFTEQEICRSKSIKSLALLEELYNSQLIVATTCMGINHPIFSRK
IFDFCIVDEASQISQPICLGPLFFSRRFVLVGDHQQLPPLVLNREARALGMSESLFKRLEQNKSAVVQLT
VQYRMNSKIMSLSNKLTYEGKLECGSDKVANAVINLRHFKDVKLELEFYADYSDNPWLMGVFEPNNPVCF
LNTDKVPAPEQVEKGGVSNVTEAKLIVFLTSIFVKAGCSPSDIGIIAPYRQQLKIINDLLARSIGMVEVN
TVDKYQGRDKSIVLVSFVRSNKDGTVGELLKDWRRLNVAITRAKHKLILLGCVPSLNCYPPLEKLLNHLN
SEKLIIDLPSREHESLCHILGDFQRE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001080449
ORF Size 3438 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001080449.1, NP_001073918
RefSeq Size 4416
RefSeq ORF 3183
Locus ID 1763
Cytogenetics 10q21.3
Protein Pathways DNA replication
MW 129.5 kDa
Gene Summary This gene encodes a member of the DNA2/NAM7 helicase family. The encoded protein is a conserved helicase/nuclease involved in the maintenance of mitochondrial and nuclear DNA stability. Mutations in this gene are associated with autosomal dominant progressive external ophthalmoplegia-6 (PEOA6) and Seckel syndrome 8. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)