ITGB6 (NM_000888) Human Tagged ORF Clone

CAT#: RC217387

Reviews ()
Write a review

ITGB6 (Myc-DDK-tagged)-Human integrin, beta 6 (ITGB6)



  "NM_000888" in other vectors (6)

Reconstitution Protocol

USD 722.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "ITGB6"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ITGB6
Synonyms AI1H
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC217387 representing NM_000888
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGATTGAACTGCTTTGCCTGTTCTTTCTATTTCTAGGAAGGAATGATCACGTACAAGGTGGCTGTG
CCCTGGGAGGTGCAGAAACCTGTGAAGACTGCCTGCTTATTGGACCTCAGTGTGCCTGGTGTGCTCAGGA
GAATTTTACTCATCCATCTGGAGTTGGCGAAAGGTGTGATACCCCAGCAAACCTTTTAGCTAAAGGATGT
CAATTAAACTTCATCGAAAACCCTGTCTCCCAAGTAGAAATACTTAAAAATAAGCCTCTCAGTGTAGGCA
GACAGAAAAATAGTTCTGACATTGTTCAGATTGCGCCTCAAAGCTTGATCCTTAAGTTGAGACCAGGTGG
TGCGCAGACTCTGCAGGTGCATGTCCGCCAGACTGAGGACTACCCGGTGGATTTGTATTACCTCATGGAC
CTCTCCGCCTCCATGGATGACGACCTCAACACAATAAAGGAGCTGGGCTCCCGGCTTTCCAAAGAGATGT
CTAAATTAACCAGCAACTTTAGACTGGGCTTCGGATCTTTTGTGGAAAAACCTGTATCCCCTTTTGTGAA
AACAACACCAGAAGAAATTGCCAACCCTTGCAGTAGTATTCCATACTTCTGTTTACCTACATTTGGATTC
AAGCACATTTTGCCATTGACAAATGATGCTGAAAGATTCAATGAAATTGTGAAGAATCAGAAAATTTCTG
CTAATATTGACACACCCGAAGGTGGATTTGATGCAATTATGCAAGCTGCTGTGTGTAAGGAAAAAATTGG
CTGGCGGAATGACTCCCTCCACCTCCTGGTCTTTGTGAGTGATGCTGATTCTCATTTTGGAATGGACAGC
AAACTAGCAGGCATCGTCATTCCTAATGACGGGCTCTGTCACTTGGACAGCAAGAATGAATACTCCATGT
CAACTGTCTTGGAATATCCAACAATTGGACAACTCATTGATAAACTGGTACAAAACAACGTGTTATTGAT
CTTCGCTGTAACCCAAGAACAAGTTCATTTATATGAGAATTACGCAAAACTTATTCCTGGAGCTACAGTA
GGTCTACTTCAGAAGGACTCCGGAAACATTCTCCAGCTGATCATCTCAGCTTATGAAGAACTGCGGTCTG
AGGTGGAACTGGAAGTATTAGGAGACACTGAAGGACTCAACTTGTCATTTACAGCCATCTGTAACAACGG
TACCCTCTTCCAACACCAAAAGAAATGCTCTCACATGAAAGTGGGAGACACAGCTTCCTTCAGCGTGACT
GTGAATATCCCACACTGCGAGAGAAGAAGCAGGCACATTATCATAAAGCCTGTGGGGCTGGGGGATGCCC
TGGAATTACTTGTCAGCCCAGAATGCAACTGCGACTGTCAGAAAGAAGTGGAAGTGAACAGCTCCAAATG
TCACCACGGGAACGGCTCTTTCCAGTGTGGGGTGTGTGCCTGCCACCCTGGCCACATGGGGCCTCGCTGT
GAGTGTGGCGAGGACATGCTGAGCACAGATTCCTGCAAGGAGGCCCCAGATCATCCCTCCTGCAGCGGAA
GGGGTGACTGCTACTGTGGGCAGTGTATCTGCCACTTGTCTCCCTATGGAAACATTTATGGGCCTTATTG
CCAGTGTGACAATTTCTCCTGCGTGAGACACAAAGGGCTGCTCTGCGGAGGTAACGGCGACTGTGACTGT
GGTGAATGTGTGTGCAGGAGCGGCTGGACTGGCGAGTACTGCAACTGCACCACCAGCACGGACTCCTGCG
TCTCTGAAGATGGAGTGCTCTGCAGCGGGCGCGGGGACTGTGTTTGTGGCAAGTGTGTTTGCACAAACCC
TGGAGCCTCAGGACCAACCTGTGAACGATGTCCTACCTGTGGTGACCCCTGTAACTCTAAACGGAGCTGC
ATTGAGTGCCACCTGTCAGCAGCTGGCCAAGCCCGAGAAGAATGTGTGGACAAGTGCAAACTAGCTGGTG
CGACCATCAGTGAAGAAGAAGATTTCTCAAAGGATGGTTCTGTTTCCTGCTCTCTGCAAGGAGAAAATGA
ATGTCTTATTACATTCCTAATAACTACAGATAATGAGGGGAAAACCATCATTCACAGCATCAATGAAAAA
GATTGTCCGAAGCCTCCAAACATTCCCATGATCATGTTAGGGGTTTCCCTGGCTATTCTTCTCATCGGGG
TTGTCCTACTGTGCATCTGGAAGCTACTGGTGTCATTTCATGATCGTAAAGAAGTTGCCAAATTTGAAGC
AGAACGATCAAAAGCCAAGTGGCAAACGGGAACCAATCCACTCTACAGAGGATCCACAAGTACTTTTAAA
AATGTAACTTATAAACACAGGGAAAAACAAAAGGTAGACCTTTCCACAGATTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217387 representing NM_000888
Red=Cloning site Green=Tags(s)

MGIELLCLFFLFLGRNDHVQGGCALGGAETCEDCLLIGPQCAWCAQENFTHPSGVGERCDTPANLLAKGC
QLNFIENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYLMD
LSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGF
KHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDS
KLAGIVIPNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATV
GLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFSVT
VNIPHCERRSRHIIIKPVGLGDALELLVSPECNCDCQKEVEVNSSKCHHGNGSFQCGVCACHPGHMGPRC
ECGEDMLSTDSCKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCDNFSCVRHKGLLCGGNGDCDC
GECVCRSGWTGEYCNCTTSTDSCVSEDGVLCSGRGDCVCGKCVCTNPGASGPTCERCPTCGDPCNSKRSC
IECHLSAAGQAREECVDKCKLAGATISEEEDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSINEK
DCPKPPNIPMIMLGVSLAILLIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFK
NVTYKHREKQKVDLSTDC

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000888
ORF Size 2364 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000888.5
RefSeq Size 2397 bp
RefSeq ORF 2367 bp
Locus ID 3694
UniProt ID P18564
Cytogenetics 2q24.2
Domains INB, PSI
Protein Families Druggable Genome, Transmembrane
Protein Pathways Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, ECM-receptor interaction, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Regulation of actin cytoskeleton
MW 85.8 kDa
Gene Summary This gene encodes a protein that is a member of the integrin superfamily. Members of this family are adhesion receptors that function in signaling from the extracellular matrix to the cell. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. The encoded protein forms a dimer with an alpha v chain and this heterodimer can bind to ligands like fibronectin and transforming growth factor beta 1. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.