BARHL2 (NM_020063) Human Tagged ORF Clone

CAT#: RC217326

BARHL2 (Myc-DDK-tagged)-Human BarH-like homeobox 2 (BARHL2)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name BARHL2 (NM_020063) Human Tagged ORF Clone
Symbol BARHL2
Synonyms BarH-like 2; OTTHUMP00000011704; BarH-like homeobox 2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC217326 representing NM_020063
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACAATGGAAGGGGCCAGCGGGTCGAGTTTTGGAATAGACACGATTTTGTCCAGTGCCAGTTCAGGCA
GCCCAGGCATGATGAATGGAGATTTCCGCCCGCTCGGTGAGGCCAGGACCGCGGATTTTAGGAGTCAGGC
CACCCCATCTCCCTGTTCGGAGATTGATACCGTAGGGACGGCGCCTTCTTCTCCTATCTCAGTCACCATG
GAGCCCCCGGAGCCGCATCTGGTAGCAGACGCGACCCAGCATCATCACCACCTCCACCACAGCCAGCAGC
CGCCGCCGCCGGCCGCGGCCCCGACGCAAAGTTTGCAGCCTTTGCCCCAACAGCAGCAGCCGCTGCCGCC
ACAGCAGCCGCCGCCGCCGCCCCCCCAGCAGCTGGGCTCGGCCGCCTCGGCCCCCAGGACTTCCACGTCT
TCTTTTTTAATTAAGGACATCTTGGGCGACAGCAAACCTCTGGCGGCATGTGCACCCTACAGCACCAGCG
TATCCTCTCCCCACCACACCCCGAAGCAGGAGAGCAACGCAGTGCACGAGAGCTTCAGGCCAAAGCTCGA
GCAGGAGGACAGCAAGACCAAACTCGACAAGCGGGAGGATTCCCAGAGCGACATCAAATGCCACGGGACA
AAGGAGGAAGGAGACCGGGAGATTACGAGTAGCCGTGAGAGTCCCCCTGTGAGAGCCAAGAAGCCTCGAA
AAGCAAGGACAGCTTTTTCCGACCACCAGCTCAATCAACTGGAGCGTAGCTTTGAGCGGCAGAAGTACCT
GAGCGTGCAGGATCGCATGGACCTGGCTGCAGCGCTCAACCTCACTGACACCCAAGTCAAGACCTGGTAC
CAGAACCGCAGGACCAAGTGGAAGCGGCAGACAGCGGTGGGCCTGGAGTTGCTGGCCGAGGCAGGGAACT
ACTCGGCGCTGCAGAGGATGTTTCCATCGCCTTATTTCTATCACCCAAGCCTGCTGGGCAGCATGGACAG
CACTACGGCGGCGGCGGCTGCCGCTGCCATGTACAGCAGCATGTACCGGACTCCTCCAGCACCCCATCCC
CAGCTGCAGCGGCCCCTGGTGCCCCGTGTGCTCATCCACGGCCTAGGGCCTGGGGGACAGCCAGCCCTTA
ATCCATTGTCCAGCCCCATCCCAGGCACCCCACACCCCCGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC217326 representing NM_020063
Red=Cloning site Green=Tags(s)

MTMEGASGSSFGIDTILSSASSGSPGMMNGDFRPLGEARTADFRSQATPSPCSEIDTVGTAPSSPISVTM
EPPEPHLVADATQHHHHLHHSQQPPPPAAAPTQSLQPLPQQQQPLPPQQPPPPPPQQLGSAASAPRTSTS
SFLIKDILGDSKPLAACAPYSTSVSSPHHTPKQESNAVHESFRPKLEQEDSKTKLDKREDSQSDIKCHGT
KEEGDREITSSRESPPVRAKKPRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWY
QNRRTKWKRQTAVGLELLAEAGNYSALQRMFPSPYFYHPSLLGSMDSTTAAAAAAAMYSSMYRTPPAPHP
QLQRPLVPRVLIHGLGPGGQPALNPLSSPIPGTPHPR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_020063
ORF Size 1161 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_020063.1, NP_064447
RefSeq Size 1496
RefSeq ORF 1164
Locus ID 343472
Cytogenetics 1p22.2
MW 41.8 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)