GLI2 (NM_005270) Human Tagged ORF Clone

CAT#: RC217291

GLI2 (Myc-DDK-tagged)-Human GLI family zinc finger 2 (GLI2)

Clone Modification / Custom Cloning Service

USD 1,999.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GLI2 (NM_005270) Human Tagged ORF Clone
Symbol GLI2
Synonyms CJS; HPE9; PHS2; THP1; THP2
Vector pCMV6-Entry
Sequence Data
>RC217291 representing NM_005270
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGACGTCTGCCTCAGCCACTGCCTCCGAGAAGCAAGAAGCCAAAAGTGGGATCCTGGAGGCCGCTG
GCTTCCCCGACCCGGGTAAAAAGGCCTCTCCTTTGGTGGTGGCTGCAGCGGCAGCAGCAGCGGTAGCTGC
CCAAGGAGTGCCGCAGCATCTCTTGCCACCATTCCATGCGCCCCTACCGATTGACATGCGACACCAGGAA
GGAAGGTACCATTACGAGCCTCATTCTGTCCACGGTGTGCACGGGCCCCCTGCCCTCAGCGGCAGCCCTG
TCATCTCTGACATCTCCTTGATCCGGCTTTCCCCGCACCCGGCTGGCCCTGGGGAGTCCCCCTTCAACGC
CCCCCACCCGTACGTGAACCCCCACATGGAGCACTACCTCCGTTCTGTGCACAGCAGCCCCACGCTCTCC
ATGATCTCTGCAGCCAGGGGCCTCAGCCCCGCTGATGTGGCCCAGGAGCACCTTAAGGAGAGGGGACTGT
TTGGCCTTCCTGCTCCAGGCACCACCCCCTCAGACTATTACCACCAGATGACCCTCGTGGCAGGCCACCC
CGCGCCCTACGGGGACCTGCTGATGCAGAGCGGGGGCGCTGCCAGCGCACCCCATCTCCACGACTACCTC
AACCCCGTGGACGTGTCCCGTTTCTCCAGCCCGCGGGTGACGCCCCGCCTGAGCCGCAAGCGGGCGCTGT
CCATCTCCCCACTCTCAGACGCCAGCCTGGACCTGCAGCGGATGATCCGCACCTCACCCAACTCGCTAGT
GGCCTACATCAACAACTCCCGAAGCAGCTCAGCGGCCAGCGGTTCCTACGGGCATCTGTCAGCGGGTGCC
CTCAGCCCAGCCTTCACCTTCCCCCACCCCATCAACCCCGTGGCCTACCAGCAGATTCTGAGCCAGCAGA
GGGGTCTGGGGTCAGCCTTTGGACACACACCACCCCTGATCCAGCCCTCACCCACCTTCCTGGCCCAGCA
GCCCATGGCCCTCACCTCCATCAATGCCACGCCCACCCAGCTCAGCAGCAGCAGCAACTGTCTGAGTGAC
ACCAACCAGAACAAGCAGAGCAGTGAGTCGGCCGTCAGCAGCACCGTCAACCCTGTCGCCATTCACAAGC
GCAGCAAGGTCAAGACCGAGCCTGAGGGCCTGCGGCCGGCCTCCCCTCTGGCGCTGACGCAGGGCCAGGT
GTCTGGACACGGCTCATGTGGGTGTGCCCTTCCCCTCTCCCAGGAGCAGCTGGCTGACCTCAAGGAAGAT
CTGGACAGGGATGACTGTAAGCAGGAGGCTGAGGTGGTCATCTATGAGACCAACTGCCACTGGGAAGACT
GCACCAAGGAGTACGACACCCAGGAGCAGCTGGTGCATCACATCAACAACGAGCACATCCACGGGGAGAA
GAAGGAGTTTGTGTGCCGCTGGCAGGCCTGCACGCGGGAGCAGAAGCCCTTCAAGGCGCAGTACATGCTG
GTGGTGCACATGCGGCGACACACGGGCGAGAAGCCCCACAAGTGCACGTTCGAGGGCTGCTCGAAGGCCT
ACTCCCGCCTGGAGAACCTGAAGACACACCTGCGGTCCCACACCGGGGAGAAGCCATATGTGTGTGAGCA
CGAGGGCTGCAACAAAGCCTTCTCCAACGCCTCGGACCGCGCCAAGCACCAGAATCGCACCCACTCCAAC
GAGAAACCCTACATCTGCAAGATCCCAGGCTGCACCAAGAGATACACAGACCCCAGCTCTCTCCGGAAGC
ATGTGAAAACGGTCCACGGCCCAGATGCCCACGTCACCAAGAAGCAGCGCAATGACGTGCACCTCCGCAC
ACCGCTGCTCAAAGAGAATGGGGACAGTGAGGCCGGCACGGAGCCTGGCGGCCCAGAGAGCACCGAGGCC
AGCAGCACCAGCCAGGCCGTGGAGGACTGCCTGCACGTCAGAGCCATCAAGACCGAGAGCTCCGGGCTGT
GTCAGTCCAGCCCCGGGGCCCAGTCGTCCTGCAGCAGCGAGCCCTCTCCTCTGGGCAGTGCCCCCAACAA
TGACAGTGGCGTGGAGATGCCGGGGACGGGGCCCGGGAGCCTGGGAGACCTGACGGCACTGGATGACACA
CCCCCAGGGGCCGACACCTCAGCCCTGGCTGCCCCCTCCGCTGGTGGCCTCCAGCTGCGCAAACACATGA
CCACCATGCACCGGTTCGAGCAGCTCAAGAAGGAGAAGCTCAAGTCACTCAAGGATTCCTGCTCATGGGC
CGGGCCGACTCCACACACGCGGAACACCAAGCTGCCTCCCCTCCCGGGAAGTGGCTCCATCCTGGAAAAC
TTCAGTGGCAGTGGGGGCGGCGGGCCCGCGGGGCTGCTGCCGAACCCGCGGCTGTCGGAGCTGTCCGCGA
GCGAGGTGACCATGCTGAGCCAGCTGCAGGAGCGCCGCGACAGCTCCACCAGCACGGTCAGCTCGGCCTA
CACCGTGAGCCGCCGCTCCTCCGGCATCTCCCCCTACTTCTCCAGCCGCCGCTCCAGCGAGGCCTCGCCC
CTGGGCGCCGGCCGCCCGCACAACGCGAGCTCCGCTGACTCCTACGACCCCATCTCCACGGACGCGTCGC
GGCGCTCGAGCGAGGCCAGCCAGTGCAGCGGCGGCTCCGGGCTGCTCAACCTCACGCCGGCGCAGCAGTA
CAGCCTGCGGGCCAAGTACGCGGCAGCCACTGGCGGCCCCCCGCCCACTCCGCTGCCGGGCCTGGAGCGC
ATGAGCCTGCGGACCAGGCTGGCGCTGCTGGACGCGCCCGAGCGCACGCTGCCCGCCGGCTGCCCACGCC
CACTGGGGCCGCGGCGTGGCAGCGACGGGCCGACCTATGGCCACGGCCACGCGGGGGCTGCGCCCGCCTT
CCCCCACGAGGCTCCAGGCGGCGGAGCCAGGCGGGCCAGCGACCCTGTGCGGCGGCCCGATGCCCTGTCC
CTGCCGCGGGTGCAGCGCTTCCACAGCACCCACAACGTGAACCCCGGCCCGCTGCCGCCCTGTGCCGACA
GGCGAGGCCTCCGCCTGCAGAGCCACCCGAGCACCGACGGCGGCCTGGCCCGCGGCGCCTACTCGCCCCG
GCCGCCTAGCATCAGCGAGAACGTGGCGATGGAGGCCGTGGCGGCAGGAGTGGACGGCGCGGGGCCCGAG
GCCGACCTGGGGCTGCCGGAGGACGACCTGGTGCTTCCAGACGACGTGGTGCAGTACATCAAGGCGCACG
CCAGTGGCGCTCTGGACGAGGGCACCGGGCAGGTGTATCCCACGGAAAGCACTGGCTTCTCTGACAACCC
CAGACTACCCAGCCCGGGGCTGCACGGCCAGCGCAGGATGGTGGCTGCGGACTCCAACGTGGGCCCCTCC
GCCCCTATGCTGGGAGGATGCCAGTTAGGCTTTGGGGCGCCCTCCAGCCTGAACAAAAATAACATGCCTG
TGCAGTGGAATGAGGTGAGCTCCGGCACCGTAGACTCCCTGGCCAGCCAGGTGAAGCCTCCACCCTTTCC
TCAGGGCAACCTGGCGGTGGTGCAGCAGAAGCCTGCCTTTGGCCAGTACCCGGGCTACAGTCCGCAAGGC
CTACAGGCTAGCCCTGGGGGCCTGGACAGCACGCAGCCACACCTGCAGCCCCGCAGCGGAGCCCCCTCCC
AGGGCATCCCCAGGGTAAACTACATGCAGCAGCTGCGACAGCCAGTGGCAGGCAGCCAGTGTCCTGGCAT
GACTACCACTATGAGCCCCCATGCCTGCTATGGCCAAGTCCACCCCCAGCTGAGCCCCAGCACCATCAGT
GGGGCCCTCAACCAGTTCCCCCAATCCTGCAGCAACATGCCAGCCAAGCCAGGGCATCTGGGGCACCCTC
AGCAGACAGAAGTGGCACCTGACCCCACCACGATGGGCAATCGCCACAGGGAACTTGGGGTCCCCGATTC
AGCCCTGGCTGGAGTGCCACCACCTCACCCAGTCCAGAGCTACCCACAGCAGAGCCATCACCTGGCAGCC
TCCATGAGCCAGGAGGGCTACCACCAGGTCCCCAGCCTTCTGCCTGCCCGCCAGCCTGGCTTCATGGAGC
CCCAAACAGGCCCGATGGGGGTGGCTACAGCAGGCTTTGGCCTAGTGCAGCCCCGGCCTCCCCTCGAGCC
CAGCCCCACTGGCCGCCACCGTGGGGTACGTGCTGTGCAGCAGCAGCTGGCCTACGCCAGGGCCACAGGC
CATGCCATGGCTGCCATGCCGTCCAGTCAGGAAACAGCAGAGGCTGTGCCCAAGGGAGCGATGGGCAACA
TGGGGTCGGTGCCTCCCCAGCCGCCTCCGCAGGACGCAGGTGGGGCCCCGGACCACAGCATGCTCTACTA
CTACGGCCAGATCCACATGTACGAACAGGATGGAGGCCTGGAGAACCTCGGGAGCTGCCAGGTCATGCGG
TCCCAGCCACCACAGCCACAGGCCTGTCAGGACAGCATCCAGCCCCAGCCCTTGCCCTCACCAGGGGTCA
ACCAGGTGTCCAGCACTGTGGACTCCCAGCTCCTGGAGGCCCCCCAGATTGACTTCGATGCCATCATGGA
TGATGGCGATCACTCGAGTTTGTTCTCGGGTGCTCTGAGCCCCAGCCTCCTCCACAGCCTCTCCCAGAAC
TCCTCCCGCCTCACCACCCCCCGAAACTCCTTGACCCTGCCCTCCATCCCCGCAGGCATCAGCAACATGG
CTGTCGGGGACATGAGCTCCATGCTCACCAGCCTCGCCGAGGAGAGCAAGTTCCTGAACATGATGACC


ACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGA
TTACAAGGATGACGACGATAAG
GTTTAA
>RC217291 representing NM_005270
Red=Cloning site Green=Tags(s)

METSASATASEKQEAKSGILEAAGFPDPGKKASPLVVAAAAAAAVAAQGVPQHLLPPFHAPLPIDMRHQE
GRYHYEPHSVHGVHGPPALSGSPVISDISLIRLSPHPAGPGESPFNAPHPYVNPHMEHYLRSVHSSPTLS
MISAARGLSPADVAQEHLKERGLFGLPAPGTTPSDYYHQMTLVAGHPAPYGDLLMQSGGAASAPHLHDYL
NPVDVSRFSSPRVTPRLSRKRALSISPLSDASLDLQRMIRTSPNSLVAYINNSRSSSAASGSYGHLSAGA
LSPAFTFPHPINPVAYQQILSQQRGLGSAFGHTPPLIQPSPTFLAQQPMALTSINATPTQLSSSSNCLSD
TNQNKQSSESAVSSTVNPVAIHKRSKVKTEPEGLRPASPLALTQGQVSGHGSCGCALPLSQEQLADLKED
LDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYML
VVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSN
EKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEA
SSTSQAVEDCLHVRAIKTESSGLCQSSPGAQSSCSSEPSPLGSAPNNDSGVEMPGTGPGSLGDLTALDDT
PPGADTSALAAPSAGGLQLRKHMTTMHRFEQLKKEKLKSLKDSCSWAGPTPHTRNTKLPPLPGSGSILEN
FSGSGGGGPAGLLPNPRLSELSASEVTMLSQLQERRDSSTSTVSSAYTVSRRSSGISPYFSSRRSSEASP
LGAGRPHNASSADSYDPISTDASRRSSEASQCSGGSGLLNLTPAQQYSLRAKYAAATGGPPPTPLPGLER
MSLRTRLALLDAPERTLPAGCPRPLGPRRGSDGPTYGHGHAGAAPAFPHEAPGGGARRASDPVRRPDALS
LPRVQRFHSTHNVNPGPLPPCADRRGLRLQSHPSTDGGLARGAYSPRPPSISENVAMEAVAAGVDGAGPE
ADLGLPEDDLVLPDDVVQYIKAHASGALDEGTGQVYPTESTGFSDNPRLPSPGLHGQRRMVAADSNVGPS
APMLGGCQLGFGAPSSLNKNNMPVQWNEVSSGTVDSLASQVKPPPFPQGNLAVVQQKPAFGQYPGYSPQG
LQASPGGLDSTQPHLQPRSGAPSQGIPRVNYMQQLRQPVAGSQCPGMTTTMSPHACYGQVHPQLSPSTIS
GALNQFPQSCSNMPAKPGHLGHPQQTEVAPDPTTMGNRHRELGVPDSALAGVPPPHPVQSYPQQSHHLAA
SMSQEGYHQVPSLLPARQPGFMEPQTGPMGVATAGFGLVQPRPPLEPSPTGRHRGVRAVQQQLAYARATG
HAMAAMPSSQETAEAVPKGAMGNMGSVPPQPPPQDAGGAPDHSMLYYYGQIHMYEQDGGLENLGSCQVMR
SQPPQPQACQDSIQPQPLPSPGVNQVSSTVDSQLLEAPQIDFDAIMDDGDHSSLFSGALSPSLLHSLSQN
SSRLTTPRNSLTLPSIPAGISNMAVGDMSSMLTSLAEESKFLNMMT

TRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-NotI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005270
ORF Size 4758 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005270.3, NM_005270.4, NP_005261
RefSeq Size 6549
RefSeq ORF 4761
Locus ID 2736
Cytogenetics 2q14.2
Protein Families ES Cell Differentiation/IPS, Adult stem cells, Cancer stem cells, Embryonic stem cells, Druggable Genome
Protein Pathways Hedgehog signaling pathway, Pathways in cancer, Basal cell carcinoma
MW 167.6 kDa
Gene Summary This gene encodes a protein which belongs to the C2H2-type zinc finger protein subclass of the Gli family. Members of this subclass are characterized as transcription factors which bind DNA through zinc finger motifs. These motifs contain conserved H-C links. Gli family zinc finger proteins are mediators of Sonic hedgehog (Shh) signaling and they are implicated as potent oncogenes in the embryonal carcinoma cell. The protein encoded by this gene localizes to the cytoplasm and activates patched Drosophila homolog (PTCH) gene expression. It is also thought to play a role during embryogenesis. The encoded protein is associated with several phenotypes- Greig cephalopolysyndactyly syndrome, Pallister-Hall syndrome, preaxial polydactyly type IV, postaxial polydactyly types A1 and B. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)