Cadherin 8(CDH8) (NM_001796) Human Tagged ORF Clone

CAT#: RC217249

CDH8 (Myc-DDK-tagged)-Human cadherin 8, type 2 (CDH8)

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cadherin 8(CDH8) (NM_001796) Human Tagged ORF Clone
Symbol CDH8
Synonyms Nbla04261
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC217249 representing NM_001796
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAGAACGGCTAGCGGAAATGCTCTTGGATCTCTGGACTCCATTAATAATATTATGGATTACTCTTC
CCCCTTGCATTTACATGGCTCCGATGAATCAGTCTCAAGTTTTAATGAGTGGATCCCCTTTGGAACTAAA
CAGTCTGGGTGAAGAACAGCGAATTTTGAACCGCTCCAAAAGAGGCTGGGTTTGGAATCAAATGTTTGTC
CTGGAAGAGTTTTCTGGACCTGAACCGATTCTTGTTGGCCGGCTACACACAGACCTGGATCCTGGGAGCA
AAAAAATCAAGTATATCCTATCAGGTGATGGAGCTGGGACCATATTTCAAATAAATGATGTAACTGGAGA
TATCCATGCTATAAAAAGACTTGACCGGGAGGAAAAGGCTGAGTATACCCTAACAGCTCAAGCAGTGGAC
TGGGAGACAAGCAAACCTCTGGAGCCTCCTTCTGAATTTATTATTAAAGTTCAAGACATCAATGACAATG
CACCAGAGTTTCTTAATGGACCCTATCATGCTACTGTGCCAGAAATGTCCATTTTGGGTACATCTGTCAC
TAACGTCACTGCGACCGACGCTGATGACCCAGTTTATGGAAACAGTGCAAAGTTGGTTTATAGTATATTG
GAAGGGCAGCCTTATTTTTCCATTGAGCCTGAAACAGCTATTATAAAAACTGCCCTTCCCAACATGGACA
GAGAAGCCAAGGAGGAGTACCTGGTTGTTATCCAAGCCAAAGATATGGGTGGACACTCTGGTGGCCTGTC
TGGGACCACGACACTTACAGTGACTCTTACTGATGTTAATGACAATCCTCCAAAATTTGCACAGAGCCTG
TATCACTTCTCAGTACCGGAAGATGTGGTTCTTGGCACTGCAATAGGAAGGGTGAAGGCCAATGATCAGG
ATATTGGTGAAAATGCACAGTCATCATATGATATCATCGATGGAGATGGAACAGCACTTTTTGAAATCAC
TTCTGATGCCCAGGCCCAGGATGGCATTATAAGGCTAAGAAAACCTCTGGACTTTGAGACCAAAAAATCC
TATACGCTAAAGGTAGAGGCAGCCAATGTCCATATTGACCCACGCTTCAGTGGCAGGGGGCCCTTTAAAG
ACACGGCGACAGTCAAAATCGTGGTTGAAGATGCTGATGAGCCTCCGGTCTTCTCTTCACCGACTTACCT
ACTTGAAGTTCATGAAAATGCTGCTCTAAACTCCGTGATTGGGCAAGTGACTGCTCGTGACCCTGATATC
ACTTCCAGTCCTATAAGGTTTTCCATCGACCGGCACACTGACCTGGAGAGGCAGTTCAACATTAATGCAG
ACGATGGGAAGATAACGCTGGCAACACCACTTGACAGAGAATTAAGTGTATGGCACAACATAACAATCAT
TGCTACTGAAATTAGGAACCACAGTCAGATATCACGAGTACCTGTTGCTATTAAAGTGCTGGATGTCAAT
GACAACGCCCCTGAATTCGCATCCGAATATGAGGCATTTTTATGTGAAAATGGAAAACCCGGCCAAGTCA
TTCAAACTGTTAGCGCCATGGACAAAGATGATCCCAAAAACGGACATTATTTCTTATACAGTCTCCTTCC
AGAAATGGTCAACAATCCGAATTTCACCATCAAGAAAAATGAAGATAATTCCCTCAGTATTTTGGCAAAG
CATAATGGATTCAACCGCCAGAAGCAAGAAGTCTATCTTTTACCAATCATAATCAGTGATAGTGGAAATC
CTCCACTGAGCAGCACTAGCACCTTGACAATCAGGGTCTGTGGCTGCAGCAATGACGGTGTCGTCCAGTC
TTGCAATGTCGAAGCTTATGTCCTTCCAATTGGACTCAGTATGGGCGCCTTAATTGCCATATTAGCATGC
ATCATTTTGCTGTTAGTCATCGTGGTGCTGTTTGTAACTCTACGGCGGCATAAAAATGAACCATTAATTA
TCAAAGATGATGAAGACGTTCGAGAAAACATCATTCGCTACGATGATGAAGGAGGAGGGGAGGAGGACAC
AGAGGCTTTTGACATTGCAACTTTACAAAATCCAGATGGAATTAATGGATTTTTACCCCGTAAGGATATT
AAACCAGATTTGCAGTTTATGCCAAGGCAAGGGCTTGCTCCAGTTCCAAATGGTGTTGATGTCGATGAAT
TTATAAATGTAAGGCTGCATGAGGCAGATAATGATCCCACGGCCCCGCCATATGACTCCATTCAGATATA
TGGCTATGAAGGCCGAGGGTCAGTGGCTGGCTCCCTCAGCTCCTTGGAGTCCACCACATCAGACTCAGAC
CAGAATTTTGACTACCTCAGTGACTGGGGTCCCCGCTTTAAGAGACTGGGCGAACTCTACTCTGTTGGTG
AAAGTGACAAAGAAACT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC217249 representing NM_001796
Red=Cloning site Green=Tags(s)

MPERLAEMLLDLWTPLIILWITLPPCIYMAPMNQSQVLMSGSPLELNSLGEEQRILNRSKRGWVWNQMFV
LEEFSGPEPILVGRLHTDLDPGSKKIKYILSGDGAGTIFQINDVTGDIHAIKRLDREEKAEYTLTAQAVD
WETSKPLEPPSEFIIKVQDINDNAPEFLNGPYHATVPEMSILGTSVTNVTATDADDPVYGNSAKLVYSIL
EGQPYFSIEPETAIIKTALPNMDREAKEEYLVVIQAKDMGGHSGGLSGTTTLTVTLTDVNDNPPKFAQSL
YHFSVPEDVVLGTAIGRVKANDQDIGENAQSSYDIIDGDGTALFEITSDAQAQDGIIRLRKPLDFETKKS
YTLKVEAANVHIDPRFSGRGPFKDTATVKIVVEDADEPPVFSSPTYLLEVHENAALNSVIGQVTARDPDI
TSSPIRFSIDRHTDLERQFNINADDGKITLATPLDRELSVWHNITIIATEIRNHSQISRVPVAIKVLDVN
DNAPEFASEYEAFLCENGKPGQVIQTVSAMDKDDPKNGHYFLYSLLPEMVNNPNFTIKKNEDNSLSILAK
HNGFNRQKQEVYLLPIIISDSGNPPLSSTSTLTIRVCGCSNDGVVQSCNVEAYVLPIGLSMGALIAILAC
IILLLVIVVLFVTLRRHKNEPLIIKDDEDVRENIIRYDDEGGGEEDTEAFDIATLQNPDGINGFLPRKDI
KPDLQFMPRQGLAPVPNGVDVDEFINVRLHEADNDPTAPPYDSIQIYGYEGRGSVAGSLSSLESTTSDSD
QNFDYLSDWGPRFKRLGELYSVGESDKET

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001796
ORF Size 2397 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001796.2, NM_001796.3, NM_001796.4, NP_001787
RefSeq Size 2929
RefSeq ORF 2400
Locus ID 1006
Cytogenetics 16q21
Domains Cadherin_C_term, CA
Protein Families Transmembrane
MW 88.25 kDa
Gene Summary Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations