Angiopoietin 2(ANGPT2) (NM_001147) Human Tagged ORF Clone

CAT#: RC217216

  • TrueORF®

ANGPT2 (Myc-DDK-tagged)-Human angiopoietin 2 (ANGPT2), transcript variant 1

  View "NM_001147" in other vectors (10)

USD 590.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Angiopoietin 2(ANGPT2) (NM_001147) Human Tagged ORF Clone
Symbol ANGPT2
Synonyms AGPT2; ANG2
Vector pCMV6-Entry
Sequence Data
>RC217216 representing NM_001147
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGCAGATTGTTTTCTTTACTCTGAGCTGTGATCTTGTCTTGGCCGCAGCCTATAACAACTTTCGGA
AGAGCATGGACAGCATAGGAAAGAAGCAATATCAGGTCCAGCATGGGTCCTGCAGCTACACTTTCCTCCT
GCCAGAGATGGACAACTGCCGCTCTTCCTCCAGCCCCTACGTGTCCAATGCTGTGCAGAGGGACGCGCCG
CTCGAATACGATGACTCGGTGCAGAGGCTGCAAGTGCTGGAGAACATCATGGAAAACAACACTCAGTGGC
TAATGAAGCTTGAGAATTATATCCAGGACAACATGAAGAAAGAAATGGTAGAGATACAGCAGAATGCAGT
ACAGAACCAGACGGCTGTGATGATAGAAATAGGGACAAACCTGTTGAACCAAACAGCTGAGCAAACGCGG
AAGTTAACTGATGTGGAAGCCCAAGTATTAAATCAGACCACGAGACTTGAACTTCAGCTCTTGGAACACT
CCCTCTCGACAAACAAATTGGAAAAACAGATTTTGGACCAGACCAGTGAAATAAACAAATTGCAAGATAA
GAACAGTTTCCTAGAAAAGAAGGTGCTAGCTATGGAAGACAAGCACATCATCCAACTACAGTCAATAAAA
GAAGAGAAAGATCAGCTACAGGTGTTAGTATCCAAGCAAAATTCCATCATTGAAGAACTAGAAAAAAAAA
TAGTGACTGCCACGGTGAATAATTCAGTTCTTCAAAAGCAGCAACATGATCTCATGGAGACAGTTAATAA
CTTACTGACTATGATGTCCACATCAAACTCAGCTAAGGACCCCACTGTTGCTAAAGAAGAACAAATCAGC
TTCAGAGACTGTGCTGAAGTATTCAAATCAGGACACACCACAAATGGCATCTACACGTTAACATTCCCTA
ATTCTACAGAAGAGATCAAGGTCTACTGTGACATGGAAGCTGGAGGAGGCGGGTGGACAATTATTCAGCG
ACGTGAGGATGGCAGCGTTGATTTTCAGAGGACTTGGAAAGAATATAAAGTGGGATTTGGTAACCCTTCA
GGAGAATATTGGCTGGGAAATGAGTTTGTTTCGCAACTGACTAATCAGCAACGCTATGTGCTTAAAATAC
ACCTTAAAGACTGGGAAGGGAATGAGGCTTACTCATTGTATGAACATTTCTATCTCTCAAGTGAAGAACT
CAATTATAGGATTCACCTTAAAGGACTTACAGGGACAGCCGGCAAAATAAGCAGCATCAGCCAACCAGGA
AATGATTTTAGCACAAAGGATGGAGACAACGACAAATGTATTTGCAAATGTTCACAAATGCTAACAGGAG
GCTGGTGGTTTGATGCATGTGGTCCTTCCAACTTGAACGGAATGTACTATCCACAGAGGCAGAACACAAA
TAAGTTCAACGGCATTAAATGGTACTACTGGAAAGGCTCAGGCTATTCGCTCAAGGCCACAACCATGATG
ATCCGACCAGCAGATTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217216 representing NM_001147
Red=Cloning site Green=Tags(s)

MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAP
LEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTR
KLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIK
EEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQIS
FRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPS
GEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPG
NDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMM
IRPADF

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001147
ORF Size 1488 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001147.1, NM_001147.2, NP_001138
RefSeq Size 2269
RefSeq ORF 1491
Locus ID 285
Cytogenetics 8p23.1
Domains FBG
Protein Families Secreted Protein, Druggable Genome
MW 56.95 kDa
Gene Summary The protein encoded by this gene is an antagonist of angiopoietin 1 (ANGPT1) and endothelial TEK tyrosine kinase (TIE-2, TEK). The encoded protein disrupts the vascular remodeling ability of ANGPT1 and may induce endothelial cell apoptosis. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].

Other Versions

Other products for "ANGPT2"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00


ANGPT2 mouse monoclonal antibody, clone OTI3H7 (formerly 3H7)
    • 100 ul

USD 360.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies