C20orf7 (NDUFAF5) (NM_024120) Human Tagged ORF Clone

SKU
RC217112
NDUFAF5 (Myc-DDK-tagged)-Human chromosome 20 open reading frame 7 (C20orf7), nuclear gene encoding mitochondrial protein, transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol C20orf7
Synonyms bA526K24.2; C20orf7; dJ842G6.1; MC1DN16
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC217112 representing NM_024120
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCGGCCGGCAGGGCTCTGGCGCTTATGTCGGCGACCTTGGGCGGCGAGGGTCCCAGCGGAGAATC
TTGGCCGTAGGGAAGTCACCTCTGGTGTCTCTCCCCGCGGTAGCACCTCGCCCAGAACCCTGAATATTTT
CGACCGGGATTTGAAAAGGAAACAGAAGAACTGGGCAGCCCGGCAGCCCGAGCCGACCAAATTTGACTAC
CTGAAGGAGGAGGTTGGAAGTCGGATCGCAGACCGTGTATATGACATACCCAGAAATTTCCCCCTTGCTT
TGGATCTTGGTTGTGGAAGAGGTTACATTGCACAATATTTGAATAAGGAAACTATTGGAAAGTTTTTCCA
AGCTGACATTGCAGAAAATGCTTTGAAAAATTCCTCAGAAACAGAAATACCTACTGTCAGCGTTTTAGCT
GATGAAGAATTCCTTCCCTTCAAAGAAAATACATTTGACCTGGTGGTTAGCAGTTTAAGTTTGCATTGGG
TGAATGACCTTCCTAGAGCACTTGAGCAGATTCATTATATTTTAAAACCAGATGGAGTGTTTATCGGTGC
AATGTTTGGAGGCGACACACTCTATGAACTTCGGTGTTCCTTACAGTTAGCGGAAACGGAAAGGGAAGGA
GGATTTTCTCCACACATTTCTCCTTTCACTGCTGTCAATGACCTGGGACATCTGCTTGGGAGAGCTGGCT
TTAATACTCTGACTGTGGACACTGATGAAATTCAAGTTAACTATCCTGGAATGTTTGAATTGATGGAAGA
TTTACAAGGTATGGGTGAGAGTAACTGTGCTTGGAATAGAAAAGCCCTGCTGCATCGAGACACAATGCTG
GCAGCTGCGGCAGTGTACAGAGAAATGTACAGAAATGAAGATGGTTCAGTACCTGCTACATACCAGATCT
ATTACATGATAGGATGGAAATATCATGAGTCACAGGCAAGACCAGCTGAAAGAGGTTCCGCAACTGTGTC
ATTTGGAGAGCTAGGAAAAATAAACAACCTTATGCCACCGGGGAAAAAATCACAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC217112 representing NM_024120
Red=Cloning site Green=Tags(s)

MLRPAGLWRLCRRPWAARVPAENLGRREVTSGVSPRGSTSPRTLNIFDRDLKRKQKNWAARQPEPTKFDY
LKEEVGSRIADRVYDIPRNFPLALDLGCGRGYIAQYLNKETIGKFFQADIAENALKNSSETEIPTVSVLA
DEEFLPFKENTFDLVVSSLSLHWVNDLPRALEQIHYILKPDGVFIGAMFGGDTLYELRCSLQLAETEREG
GFSPHISPFTAVNDLGHLLGRAGFNTLTVDTDEIQVNYPGMFELMEDLQGMGESNCAWNRKALLHRDTML
AAAAVYREMYRNEDGSVPATYQIYYMIGWKYHESQARPAERGSATVSFGELGKINNLMPPGKKSQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_024120
ORF Size 1035 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024120.5
RefSeq Size 1650 bp
RefSeq ORF 1038 bp
Locus ID 79133
UniProt ID Q5TEU4
Cytogenetics 20p12.1
Protein Families Druggable Genome
MW 38.7 kDa
Summary The NADH-ubiquinone oxidoreductase complex (complex I) of the mitochondrial respiratory chain catalyzes the transfer of electrons from NADH to ubiquinone, and consists of at least 43 subunits. The complex is located in the inner mitochondrial membrane. This gene encodes a mitochondrial protein that is associated with the matrix face of the mitochondrial inner membrane and is required for complex I assembly. A mutation in this gene results in mitochondrial complex I deficiency. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009]
Write Your Own Review
You're reviewing:C20orf7 (NDUFAF5) (NM_024120) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC217112L3 Lenti ORF clone of Human chromosome 20 open reading frame 7 (C20orf7), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC217112L4 Lenti ORF clone of Human chromosome 20 open reading frame 7 (C20orf7), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged 10 ug
$757.00
RG217112 NDUFAF5 (tGFP-tagged) - Human chromosome 20 open reading frame 7 (C20orf7), nuclear gene encoding mitochondrial protein, transcript variant 1 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC107985 NDUFAF5 (untagged)-Human chromosome 20 open reading frame 7 (C20orf7), nuclear gene encoding mitochondrial protein, transcript variant 1 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.