DCAMKL1(DCLK1) (NM_004734) Human Tagged ORF Clone

CAT#: RC217050

DCLK1 (Myc-DDK-tagged)-Human doublecortin-like kinase 1 (DCLK1), transcript variant 1

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DCAMKL1(DCLK1) (NM_004734) Human Tagged ORF Clone
Symbol DCLK1
Synonyms CL1; CLICK1; DCAMKL1; DCDC3A; DCLK
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC217050 representing NM_004734
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCTTCGGCAGAGACATGGAGCTGGAGCACTTCGACGAGCGGGATAAGGCGCAGAGATACAGCCGAG
GGTCGCGGGTGAACGGCCTGCCGAGCCCGACGCACAGCGCCCACTGCAGCTTCTACCGCACCCGCACGCT
GCAGACGCTCAGCTCCGAGAAGAAGGCCAAGAAAGTTCGTTTCTATCGAAACGGAGATCGATACTTCAAA
GGGATTGTGTATGCCATCTCCCCAGACCGGTTCCGATCTTTTGAGGCCCTGCTGGCTGATTTGACCCGAA
CTCTGTCGGATAACGTGAATTTGCCCCAGGGAGTGAGAACAATCTACACCATTGATGGGCTCAAGAAGAT
TTCCAGCCTGGACCAACTGGTGGAAGGAGAGAGTTATGTATGTGGCTCCATAGAGCCCTTCAAGAAACTG
GAGTACACCAAGAATGTGAACCCCAACTGGTCGGTGAACGTCAAGACCACCTCGGCTTCTCGGGCAGTGT
CTTCACTGGCCACTGCCAAAGGAAGCCCTTCAGAGGTGCGAGAGAATAAGGATTTCATTCGGCCCAAGCT
GGTCACCATCATCAGAAGTGGCGTGAAGCCACGGAAAGCTGTCAGGATTCTGCTGAACAAGAAAACGGCT
CATTCCTTTGAGCAGGTCCTCACCGATATCACCGATGCCATCAAGCTGGACTCGGGAGTGGTGAAACGCC
TGTACACGTTGGATGGGAAACAGGTGATGTGCCTTCAGGACTTTTTTGGTGATGATGACATTTTTATTGC
ATGTGGACCGGAGAAGTTCCGTTACCAGGATGATTTCTTGCTAGATGAAAGTGAATGTCGAGTGGTAAAG
TCCACTTCTTACACCAAAATAGCTTCATCATCCCGCAGGAGCACCACCAAGAGCCCAGGACCGTCCAGGC
GTAGCAAGTCCCCTGCCTCCACCAGCTCAGTTAATGGAACCCCTGGTAGTCAGCTCTCTACTCCGCGCTC
AGGCAAGTCGCCAAGCCCATCACCCACCAGCCCAGGAAGCCTGCGGAAGCAGAGGAGCTCTCAGCATGGC
GGCTCCTCTACGTCACTTGCGTCCACCAAAGTCTGCAGCTCGATGGATGAGAACGATGGCCCTGGAGAAG
AAGTGTCGGAGGAAGGCTTCCAGATTCCAGCTACAATAACAGAACGATATAAAGTCGGAAGAACAATAGG
AGATGGAAATTTTGCTGTTGTCAAGGAATGTGTAGAAAGATCGACTGCTAGAGAGTATGCTCTGAAAATT
ATCAAGAAAAGCAAATGTCGAGGCAAAGAGCACATGATCCAGAATGAAGTGTCTATTTTAAGAAGAGTGA
AGCATCCCAATATCGTTCTTCTGATTGAGGAGATGGATGTGCCAACTGAACTGTATCTTGTCATGGAATT
AGTAAAGGGGGGAGACCTTTTTGATGCCATTACTTCCACTAACAAATACACCGAGAGAGACGCCAGTGGG
ATGCTGTACAACCTAGCCAGCGCCATCAAATACCTGCATAGCCTGAACATCGTCCACCGTGATATCAAGC
CAGAGAACCTGCTGGTGTATGAGCACCAAGATGGCAGCAAATCACTGAAGCTGGGTGACTTTGGACTGGC
CACCATTGTAGACGGCCCCCTGTACACAGTCTGTGGCACCCCAACATACGTGGCTCCAGAAATCATTGCA
GAGACTGGATACGGCCTCAAGGTGGACATCTGGGCAGCAGGTGTAATCACTTATATCCTGCTGTGTGGTT
TCCCTCCATTCCGTGGAAGTGGTGATGACCAGGAGGTGCTTTTTGATCAGATTTTGATGGGGCAGGTGGA
CTTTCCTTCTCCATACTGGGATAATGTTTCCGATTCTGCAAAGGAGCTCATTACCATGATGCTGTTGGTC
GATGTAGATCAGCGATTTTCTGCTGTTCAAGTACTTGAGCATCCCTGGGTTAATGATGATGGCCTCCCAG
AAAATGAACATCAGCTGTCAGTAGCTGGAAAGATAAAGAAGCATTTCAACACAGGCCCCAAGCCGAATAG
CACAGCAGCTGGAGTTTCTGTCATAGCACTGGACCACGGGTTTACCATCAAGAGATCAGGGTCTTTGGAC
TACTACCAGCAACCAGGAATGTATTGGATAAGACCACCGCTCTTGATAAGGAGAGGCAGGTTTTCCGACG
AAGACGCAACCAGGATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC217050 representing NM_004734
Red=Cloning site Green=Tags(s)

MSFGRDMELEHFDERDKAQRYSRGSRVNGLPSPTHSAHCSFYRTRTLQTLSSEKKAKKVRFYRNGDRYFK
GIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISSLDQLVEGESYVCGSIEPFKKL
EYTKNVNPNWSVNVKTTSASRAVSSLATAKGSPSEVRENKDFIRPKLVTIIRSGVKPRKAVRILLNKKTA
HSFEQVLTDITDAIKLDSGVVKRLYTLDGKQVMCLQDFFGDDDIFIACGPEKFRYQDDFLLDESECRVVK
STSYTKIASSSRRSTTKSPGPSRRSKSPASTSSVNGTPGSQLSTPRSGKSPSPSPTSPGSLRKQRSSQHG
GSSTSLASTKVCSSMDENDGPGEEVSEEGFQIPATITERYKVGRTIGDGNFAVVKECVERSTAREYALKI
IKKSKCRGKEHMIQNEVSILRRVKHPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTNKYTERDASG
MLYNLASAIKYLHSLNIVHRDIKPENLLVYEHQDGSKSLKLGDFGLATIVDGPLYTVCGTPTYVAPEIIA
ETGYGLKVDIWAAGVITYILLCGFPPFRGSGDDQEVLFDQILMGQVDFPSPYWDNVSDSAKELITMMLLV
DVDQRFSAVQVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLD
YYQQPGMYWIRPPLLIRRGRFSDEDATRM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004734
ORF Size 2187 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004734.1, NM_004734.2, NM_004734.3, NM_004734.4, NP_004725
RefSeq Size 5703
RefSeq ORF 2190
Locus ID 9201
Cytogenetics 13q13.3
Domains pkinase, TyrKc, S_TKc, DCX
Protein Families Protein Kinase, Druggable Genome
MW 80.9 kDa
Gene Summary Probable kinase that may be involved in a calcium-signaling pathway controlling neuronal migration in the developing brain. May also participate in functions of the mature nervous system. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations