GLI3 (NM_000168) Human Tagged ORF Clone

CAT#: RC216945

GLI3 (Myc-DDK-tagged)-Human GLI family zinc finger 3 (GLI3)

Change vector?

  • TrueORF®

USD 824


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GLI3 (NM_000168) Human Tagged ORF Clone
Symbol GLI3
Synonyms ACLS; GCPS; GLI3-190; GLI3FL; PAP-A; PAPA; PAPA1; PAPB; PHS; PPDIV
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC216945 representing NM_000168
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCCCAGTCCCACAGCTCCACGACCACTGAAAAGAAAAAAGTTGAGAATTCCATAGTGAAGTGCT
CCACTCGAACAGATGTGAGCGAGAAAGCCGTTGCCTCCAGCACCACTTCTAATGAGGATGAAAGTCCTGG
ACAGACTTATCACAGAGAGAGAAGAAACGCAATCACTATGCAGCCACAGAATGTCCAGGGGCTCAGCAAA
GTCAGTGAGGAACCTTCAACATCGAGTGACGAGAGGGCCTCATTGATCAAGAAAGAGATCCATGGGTCCC
TGCCACACGTGGCGGAGCCCTCTGTGCCGTACCGCGGGACGGTGTTTGCCATGGACCCCAGGAATGGTTA
CATGGAGCCCCACTACCACCCTCCTCATCTTTTCCCTGCCTTCCATCCTCCTGTACCAATTGATGCCAGA
CATCATGAGGGCCGTTACCATTACGATCCATCTCCGATTCCTCCATTGCATATGACTTCCGCCTTATCTA
GTAGCCCTACGTATCCGGACCTGCCCTTCATTAGGATCTCCCCACACCGGAACCCCACTGCTGCTTCCGA
GTCTCCCTTCAGCCCTCCACATCCCTACATTAATCCCTACATGGACTATATCCGCTCCTTGCACAGCAGC
CCATCGCTCTCCATGATCTCAGCAACCCGTGGGCTGAGCCCTACAGATGCGCCCCATGCAGGAGTCAGCC
CAGCAGAATACTATCATCAGATGGCCCTGCTAACTGGCCAGCGCAGCCCCTATGCAGACATTATTCCCTC
AGCTGCCACCGCCGGCACGGGGGCCATCCACATGGAATATCTTCATGCTATGGATAGCACCAGATTCTCC
AGCCCCAGGCTGTCAGCCAGGCCGAGCCGAAAACGTACACTGTCCATATCACCACTCTCCGATCATAGCT
TTGACCTTCAGACCATGATAAGGACGTCTCCCAACTCCTTGGTCACGATTCTCAATAATTCCCGTAGCAG
CTCTTCAGCAAGTGGCTCCTATGGTCACTTATCTGCAAGTGCAATCAGCCCTGCCTTGAGCTTCACCTAC
TCTTCCGCGCCCGTCTCTCTCCACATGCATCAGCAGATCCTAAGCCGACAACAGAGCTTAGGTTCAGCCT
TTGGACACAGCCCTCCACTCATCCACCCTGCCCCAACTTTTCCAACACAGAGGCCTATTCCAGGGATCCC
TACGGTTCTGAACCCCGTCCAGGTCAGCTCCGGCCCTTCTGAGTCCTCACAGAACAAGCCCACGAGTGAG
TCTGCAGTGAGCAGCACTGGTGACCCGATGCACAACAAGAGGTCCAAGATCAAACCCGATGAAGACCTCC
CCAGCCCAGGGGCTCGGGGGCAGCAGGAACAGCCCGAAGGAACAACCCTTGTCAAGGAGGAAGGGGACAA
AGATGAAAGCAAACAGGAGCCTGAAGTCATCTATGAGACAAACTGCCACTGGGAAGGCTGCGCGAGGGAG
TTCGACACCCAAGAGCAGCTTGTGCACCATATAAATAACGACCATATTCATGGAGAGAAGAAGGAGTTCG
TGTGCAGGTGGCTGGACTGCTCAAGAGAGCAGAAACCCTTCAAAGCCCAGTATATGTTGGTAGTGCATAT
GAGAAGACACACGGGCGAGAAGCCTCACAAATGCACTTTTGAAGGTTGCACAAAGGCCTACTCGAGACTA
GAAAACTTGAAAACACACTTGAGATCTCACACTGGAGAGAAACCATACGTCTGTGAGCACGAAGGTTGCA
ACAAGGCTTTCTCAAATGCCTCTGATCGCGCCAAACACCAAAACAGAACGCATTCCAATGAGAAACCATA
TGTGTGCAAAATCCCAGGCTGCACTAAGCGTTACACAGACCCAAGCTCCCTCCGGAAACATGTGAAGACA
GTGCATGGCCCAGAGGCTCATGTCACCAAGAAGCAGCGAGGGGACATCCATCCTCGGCCGCCACCCCCGA
GAGATTCCGGCAGCCATTCACAGTCCAGGTCGCCTGGCCGACCGACTCAGGGAGCCCTTGGTGAGCAGCA
GGACCTCAGCAACACTACCTCAAAGCGGGAAGAATGCCTCCAGGTGAAAACCGTCAAGGCAGAGAAGCCA
ATGACATCTCAGCCAAGCCCTGGTGGTCAGTCTTCATGCAGCAGCCAACAGTCCCCCATCAGCAACTATT
CCAACAGTGGGCTCGAGCTTCCTCTGACCGATGGAGGTAGTATAGGAGACCTCAGTGCCATCGATGAAAC
CCCAATCATGGACTCAACCATTTCCACTGCAACCACAGCCCTTGCTTTGCAAGCCAGGAGAAACCCGGCA
GGGACCAAATGGATGGAGCACGTAAAACTAGAAAGGCTAAAACAAGTGAATGGAATGTTTCCGCGACTGA
ACCCCATTCTACCCCCTAAAGCCCCTGCGGTCTCTCCTCTCATAGGAAATGGCACACAGTCCAACAACAC
CTGCAGCTTGGGTGGGCCCATGACGCTTCTCCCGGGCAGAAGCGACCTCTCTGGGGTGGACGTCACTATG
CTGAACATGCTCAACAGAAGGGACAGCAGCGCCAGCACCATCAGCTCGGCCTACCTGAGCAGCCGCCGCT
CCTCAGGGATCTCGCCCTGCTTCTCCAGCCGCCGCTCCAGCGAGGCGTCACAGGCCGAGGGCCGGCCGCA
GAACGTGAGCGTGGCCGACTCCTACGACCCCATCTCCACCGACGCCTCGCGCCGCTCCAGCGAAGCCAGC
CAGAGCGACGGCCTGCCCAGCCTGCTCAGCCTCACGCCCGCCCAGCAGTACCGCCTCAAGGCCAAGTACG
CGGCTGCCACAGGAGGGCCGCCGCCGACGCCCCTGCCCAACATGGAGAGGATGAGCCTGAAGACGCGCCT
GGCGCTGCTCGGGGATGCCCTCGAGCCTGGCGTGGCCCTGCCTCCAGTTCATGCCCCGAGGAGGTGCAGC
GACGGGGGAGCCCACGGCTACGGGCGGCGCCACCTGCAGCCGCACGATGCGCCGGGCCACGGCGTGAGGA
GGGCCAGCGACCCGGTGCGGACAGGCTCCGAGGGCCTGGCCCTGCCTCGTGTGCCGCGCTTCAGCAGCCT
CAGCAGCTGCAACCCCCCGGCGATGGCCACGTCCGCGGAGAAGCGCAGTCTCGTGCTTCAGAATTACACG
CGGCCCGAGGGCGGCCAGTCCCGAAACTTCCACTCGTCCCCCTGTCCTCCCAGCATCACCGAGAACGTCA
CCCTGGAGTCCCTGACCATGGACGCTGATGCCAACCTGAACGATGAGGATTTCCTGCCGGACGACGTGGT
GCAGTATTTAAATTCCCAGAACCAAGCAGGGTACGAGCAGCACTTCCCCAGCGCCCTCCCGGACGACAGC
AAAGTGCCCCACGGGCCCGGTGACTTTGACGCGCCCGGGCTGCCAGACAGCCACGCTGGCCAGCAGTTCC
ATGCCCTCGAGCAGCCCTGCCCCGAGGGCAGCAAAACCGACCTGCCCATTCAGTGGAACGAAGTCAGCTC
CGGAAGCGCCGACCTGTCCTCCTCCAAGCTCAAGTGTGGGCCGCGGCCCGCTGTGCCGCAGACTCGCGCC
TTTGGGTTCTGCAACGGCATGGTCGTCCACCCGCAGAACCCCTTGAGGAGCGGGCCTGCTGGGGGCTATC
AGACCCTCGGGGAGAACAGCAACCCCTACGGTGGCCCAGAGCACTTGATGCTCCACAACAGCCCCGGAAG
TGGCACCAGTGGAAACGCCTTCCATGAACAGCCCTGTAAGGCCCCGCAGTATGGGAACTGTCTCAACAGG
CAGCCAGTGGCCCCTGGTGCACTCGACGGTGCCTGTGGTGCCGGGATTCAAGCCTCAAAGCTGAAGAGCA
CCCCCATGCAAGGGAGCGGGGGCCAGCTGAATTTCGGCCTGCCGGTAGCGCCAAATGAGTCAGCTGGCAG
CATGGTGAATGGCATGCAGAACCAGGACCCAGTGGGACAGGGGTACCTGGCTCACCAGCTCCTCGGCGAC
AGCATGCAGCACCCGGGGGCAGGCCGCCCCGGTCAGCAGATGCTTGGGCAGATTAGTGCTACCTCACACA
TCAACATCTACCAAGGGCCAGAGAGCTGCCTGCCAGGGGCTCACGGCATGGGCAGCCAGCCGTCAAGCTT
GGCAGTTGTCAGGGGCTACCAGCCATGTGCCAGCTTTGGGGGCAGCAGGCGCCAGGCTATGCCGAGGGAC
AGCCTTGCTCTGCAGTCAGGACAGCTCAGTGACACAAGTCAGACCTGCAGGGTGAATGGTATCAAGATGG
AGATGAAAGGGCAGCCCCATCCGCTGTGCTCTAATCTGCAGAATTACTCTGGTCAGTTCTATGACCAAAC
CGTGGGCTTCAGTCAGCAAGACACGAAAGCTGGTTCATTCTCTATTTCAGACGCCAGCTGCCTGCTACAG
GGGACCAGCGCCAAAAACTCTGAGTTACTTTCCCCAGGTGCTAATCAGGTGACAAGCACAGTGGACAGCC
TCGACAGCCATGACCTGGAAGGGGTACAGATTGACTTCGATGCCATCATAGACGATGGGGACCACTCCAG
CCTGATGTCGGGGGCCCTGAGCCCAAGTATCATTCAGAACCTTTCCCATAGCTCCTCCCGCCTCACCACG
CCTCGGGCGTCCCTCCCATTCCCAGCGCTGTCCATGAGCACCACCAACATGGCTATCGGGGACATGAGTT
CTTTGCTGACCTCCCTAGCGGAAGAAAGCAAATTCCTTGCAGTTATGCAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC216945 representing NM_000168
Red=Cloning site Green=Tags(s)

MEAQSHSSTTTEKKKVENSIVKCSTRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITMQPQNVQGLSK
VSEEPSTSSDERASLIKKEIHGSLPHVAEPSVPYRGTVFAMDPRNGYMEPHYHPPHLFPAFHPPVPIDAR
HHEGRYHYDPSPIPPLHMTSALSSSPTYPDLPFIRISPHRNPTAASESPFSPPHPYINPYMDYIRSLHSS
PSLSMISATRGLSPTDAPHAGVSPAEYYHQMALLTGQRSPYADIIPSAATAGTGAIHMEYLHAMDSTRFS
SPRLSARPSRKRTLSISPLSDHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTY
SSAPVSLHMHQQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQNKPTSE
SAVSSTGDPMHNKRSKIKPDEDLPSPGARGQQEQPEGTTLVKEEGDKDESKQEPEVIYETNCHWEGCARE
FDTQEQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCTKAYSRL
ENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYVCKIPGCTKRYTDPSSLRKHVKT
VHGPEAHVTKKQRGDIHPRPPPPRDSGSHSQSRSPGRPTQGALGEQQDLSNTTSKREECLQVKTVKAEKP
MTSQPSPGGQSSCSSQQSPISNYSNSGLELPLTDGGSIGDLSAIDETPIMDSTISTATTALALQARRNPA
GTKWMEHVKLERLKQVNGMFPRLNPILPPKAPAVSPLIGNGTQSNNTCSLGGPMTLLPGRSDLSGVDVTM
LNMLNRRDSSASTISSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPISTDASRRSSEAS
QSDGLPSLLSLTPAQQYRLKAKYAAATGGPPPTPLPNMERMSLKTRLALLGDALEPGVALPPVHAPRRCS
DGGAHGYGRRHLQPHDAPGHGVRRASDPVRTGSEGLALPRVPRFSSLSSCNPPAMATSAEKRSLVLQNYT
RPEGGQSRNFHSSPCPPSITENVTLESLTMDADANLNDEDFLPDDVVQYLNSQNQAGYEQHFPSALPDDS
KVPHGPGDFDAPGLPDSHAGQQFHALEQPCPEGSKTDLPIQWNEVSSGSADLSSSKLKCGPRPAVPQTRA
FGFCNGMVVHPQNPLRSGPAGGYQTLGENSNPYGGPEHLMLHNSPGSGTSGNAFHEQPCKAPQYGNCLNR
QPVAPGALDGACGAGIQASKLKSTPMQGSGGQLNFGLPVAPNESAGSMVNGMQNQDPVGQGYLAHQLLGD
SMQHPGAGRPGQQMLGQISATSHINIYQGPESCLPGAHGMGSQPSSLAVVRGYQPCASFGGSRRQAMPRD
SLALQSGQLSDTSQTCRVNGIKMEMKGQPHPLCSNLQNYSGQFYDQTVGFSQQDTKAGSFSISDASCLLQ
GTSAKNSELLSPGANQVTSTVDSLDSHDLEGVQIDFDAIIDDGDHSSLMSGALSPSIIQNLSHSSSRLTT
PRASLPFPALSMSTTNMAIGDMSSLLTSLAEESKFLAVMQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000168
ORF Size 4740 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000168.2, NM_000168.3, NM_000168.4, NM_000168.5, NP_000159
RefSeq Size 8228
RefSeq ORF 4743
Locus ID 2737
Cytogenetics 7p14.1
Domains ZnF_C2H2
Protein Families ES Cell Differentiation/IPS, Adult stem cells, Cancer stem cells, Embryonic stem cells, Druggable Genome
Protein Pathways Hedgehog signaling pathway, Pathways in cancer, Basal cell carcinoma
MW 169.86 kDa
Gene Summary This gene encodes a protein which belongs to the C2H2-type zinc finger proteins subclass of the Gli family. They are characterized as DNA-binding transcription factors and are mediators of Sonic hedgehog (Shh) signaling. The protein encoded by this gene localizes in the cytoplasm and activates patched Drosophila homolog (PTCH) gene expression. It is also thought to play a role during embryogenesis. Mutations in this gene have been associated with several diseases, including Greig cephalopolysyndactyly syndrome, Pallister-Hall syndrome, preaxial polydactyly type IV, and postaxial polydactyly types A1 and B. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations