TRPM4 (NM_017636) Human Tagged ORF Clone

CAT#: RC216888

Reviews ()
Write a review

TRPM4 (Myc-DDK-tagged)-Human transient receptor potential cation channel, subfamily M, member 4 (TRPM4), transcript variant 1



  "NM_017636" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,439.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TRPM4
Synonyms EKVP6; hTRPM4; LTrpC4; PFHB1B; TRPM4B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC216888 representing NM_017636
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGGTGCCGGAGAAGGAGCAGAGCTGGATCCCCAAGATCTTCAAGAAGAAGACCTGCACGACGTTCA
TAGTTGACTCCACAGATCCGGGAGGGACCTTGTGCCAGTGTGGGCGCCCCCGGACCGCCCACCCCGCAGT
GGCCATGGAGGATGCCTTCGGGGCAGCCGTGGTGACCGTGTGGGACAGCGATGCACACACCACGGAGAAG
CCCACCGATGCCTACGGAGAGCTGGACTTCACGGGGGCCGGCCGCAAGCACAGCAATTTCCTCCGGCTCT
CTGACCGAACGGATCCAGCTGCAGTTTATAGTCTGGTCACACGCACATGGGGCTTCCGTGCCCCGAACCT
GGTGGTGTCAGTGCTGGGGGGATCGGGGGGCCCCGTCCTCCAGACCTGGCTGCAGGACCTGCTGCGTCGT
GGGCTGGTGCGGGCTGCCCAGAGCACAGGAGCCTGGATTGTCACTGGGGGTCTGCACACGGGCATCGGCC
GGCATGTTGGTGTGGCTGTACGGGACCATCAGATGGCCAGCACTGGGGGCACCAAGGTGGTGGCCATGGG
TGTGGCCCCCTGGGGTGTGGTCCGGAATAGAGACACCCTCATCAACCCCAAGGGCTCGTTCCCTGCGAGG
TACCGGTGGCGCGGTGACCCGGAGGACGGGGTCCAGTTTCCCCTGGACTACAACTACTCGGCCTTCTTCC
TGGTGGACGACGGCACACACGGCTGCCTGGGGGGCGAGAACCGCTTCCGCTTGCGCCTGGAGTCCTACAT
CTCACAGCAGAAGACGGGCGTGGGAGGGACTGGAATTGACATCCCTGTCCTGCTCCTCCTGATTGATGGT
GATGAGAAGATGTTGACGCGAATAGAGAACGCCACCCAGGCTCAGCTCCCATGTCTCCTCGTGGCTGGCT
CAGGGGGAGCTGCGGACTGCCTGGCGGAGACCCTGGAAGACACTCTGGCCCCAGGGAGTGGGGGAGCCAG
GCAAGGCGAAGCCCGAGATCGAATCAGGCGTTTCTTTCCCAAAGGGGACCTTGAGGTCCTGCAGGCCCAG
GTGGAGAGGATTATGACCCGGAAGGAGCTCCTGACAGTCTATTCTTCTGAGGATGGGTCTGAGGAATTCG
AGACCATAGTTTTGAAGGCCCTTGTGAAGGCCTGTGGGAGCTCGGAGGCCTCAGCCTACCTGGATGAGCT
GCGTTTGGCTGTGGCTTGGAACCGCGTGGACATTGCCCAGAGTGAACTCTTTCGGGGGGACATCCAATGG
CGGTCCTTCCATCTCGAAGCTTCCCTCATGGACGCCCTGCTGAATGACCGGCCTGAGTTCGTGCGCTTGC
TCATTTCCCACGGCCTCAGCCTGGGCCACTTCCTGACCCCGATGCGCCTGGCCCAACTCTACAGCGCGGC
GCCCTCCAACTCGCTCATCCGCAACCTTTTGGACCAGGCGTCCCACAGCGCAGGCACCAAAGCCCCAGCC
CTAAAAGGGGGAGCTGCGGAGCTCCGGCCCCCTGACGTGGGGCATGTGCTGAGGATGCTGCTGGGGAAGA
TGTGCGCGCCGAGGTACCCCTCCGGGGGCGCCTGGGACCCTCACCCAGGCCAGGGCTTCGGGGAGAGCAT
GTATCTGCTCTCGGACAAGGCCACCTCGCCGCTCTCGCTGGATGCTGGCCTCGGGCAGGCCCCCTGGAGC
GACCTGCTTCTTTGGGCACTGTTGCTGAACAGGGCACAGATGGCCATGTACTTCTGGGAGATGGGTTCCA
ATGCAGTTTCCTCAGCTCTTGGGGCCTGTTTGCTGCTCCGGGTGATGGCACGCCTGGAGCCTGACGCTGA
GGAGGCAGCACGGAGGAAAGACCTGGCGTTCAAGTTTGAGGGGATGGGCGTTGACCTCTTTGGCGAGTGC
TATCGCAGCAGTGAGGTGAGGGCTGCCCGCCTCCTCCTCCGTCGCTGCCCGCTCTGGGGGGATGCCACTT
GCCTCCAGCTGGCCATGCAAGCTGACGCCCGTGCCTTCTTTGCCCAGGATGGGGTACAGTCTCTGCTGAC
ACAGAAGTGGTGGGGAGATATGGCCAGCACTACACCCATCTGGGCCCTGGTTCTCGCCTTCTTTTGCCCT
CCACTCATCTACACCCGCCTCATCACCTTCAGGAAATCAGAAGAGGAGCCCACACGGGAGGAGCTAGAGT
TTGACATGGATAGTGTCATTAATGGGGAAGGGCCTGTCGGGACGGCGGACCCAGCCGAGAAGACGCCGCT
GGGGGTCCCGCGCCAGTCGGGCCGTCCGGGTTGCTGCGGGGGCCGCTGCGGGGGGCGCCGGTGCCTACGC
CGCTGGTTCCACTTCTGGGGCGCGCCGGTGACCATCTTCATGGGCAACGTGGTCAGCTACCTGCTGTTCC
TGCTGCTTTTCTCGCGGGTGCTGCTCGTGGATTTCCAGCCGGCGCCGCCCGGCTCCCTGGAGCTGCTGCT
CTATTTCTGGGCTTTCACGCTGCTGTGCGAGGAACTGCGCCAGGGCCTGAGCGGAGGCGGGGGCAGCCTC
GCCAGCGGGGGCCCCGGGCCTGGCCATGCCTCACTGAGCCAGCGCCTGCGCCTCTACCTCGCCGACAGCT
GGAACCAGTGCGACCTAGTGGCTCTCACCTGCTTCCTCCTGGGCGTGGGCTGCCGGCTGACCCCGGGTTT
GTACCACCTGGGCCGCACTGTCCTCTGCATCGACTTCATGGTTTTCACGGTGCGGCTGCTTCACATCTTC
ACGGTCAACAAACAGCTGGGGCCCAAGATCGTCATCGTGAGCAAGATGATGAAGGACGTGTTCTTCTTCC
TCTTCTTCCTCGGCGTGTGGCTGGTAGCCTATGGCGTGGCCACGGAGGGGCTCCTGAGGCCACGGGACAG
TGACTTCCCAAGTATCCTGCGCCGCGTCTTCTACCGTCCCTACCTGCAGATCTTCGGGCAGATTCCCCAG
GAGGACATGGACGTGGCCCTCATGGAGCACAGCAACTGCTCGTCGGAGCCCGGCTTCTGGGCACACCCTC
CTGGGGCCCAGGCGGGCACCTGCGTCTCCCAGTATGCCAACTGGCTGGTGGTGCTGCTCCTCGTCATCTT
CCTGCTCGTGGCCAACATCCTGCTGGTCAACTTGCTCATTGCCATGTTCAGTTACACATTCGGCAAAGTA
CAGGGCAACAGCGATCTCTACTGGAAGGCGCAGCGTTACCGCCTCATCCGGGAATTCCACTCTCGGCCCG
CGCTGGCCCCGCCCTTTATCGTCATCTCCCACTTGCGCCTCCTGCTCAGGCAATTGTGCAGGCGACCCCG
GAGCCCCCAGCCGTCCTCCCCGGCCCTCGAGCATTTCCGGGTTTACCTTTCTAAGGAAGCCGAGCGGAAG
CTGCTAACGTGGGAATCGGTGCATAAGGAGAACTTTCTGCTGGCACGCGCTAGGGACAAGCGGGAGAGCG
ACTCCGAGCGTCTGAAGCGCACGTCCCAGAAGGTGGACTTGGCACTGAAACAGCTGGGACACATCCGCGA
GTACGAACAGCGCCTGAAAGTGCTGGAGCGGGAGGTCCAGCAGTGTAGCCGCGTCCTGGGGTGGGTGGCC
GAGGCCCTGAGCCGCTCTGCCTTGCTGCCCCCAGGTGGGCCGCCACCCCCTGACCTGCCTGGGTCCAAAG
AC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC216888 representing NM_017636
Red=Cloning site Green=Tags(s)

MVVPEKEQSWIPKIFKKKTCTTFIVDSTDPGGTLCQCGRPRTAHPAVAMEDAFGAAVVTVWDSDAHTTEK
PTDAYGELDFTGAGRKHSNFLRLSDRTDPAAVYSLVTRTWGFRAPNLVVSVLGGSGGPVLQTWLQDLLRR
GLVRAAQSTGAWIVTGGLHTGIGRHVGVAVRDHQMASTGGTKVVAMGVAPWGVVRNRDTLINPKGSFPAR
YRWRGDPEDGVQFPLDYNYSAFFLVDDGTHGCLGGENRFRLRLESYISQQKTGVGGTGIDIPVLLLLIDG
DEKMLTRIENATQAQLPCLLVAGSGGAADCLAETLEDTLAPGSGGARQGEARDRIRRFFPKGDLEVLQAQ
VERIMTRKELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDIAQSELFRGDIQW
RSFHLEASLMDALLNDRPEFVRLLISHGLSLGHFLTPMRLAQLYSAAPSNSLIRNLLDQASHSAGTKAPA
LKGGAAELRPPDVGHVLRMLLGKMCAPRYPSGGAWDPHPGQGFGESMYLLSDKATSPLSLDAGLGQAPWS
DLLLWALLLNRAQMAMYFWEMGSNAVSSALGACLLLRVMARLEPDAEEAARRKDLAFKFEGMGVDLFGEC
YRSSEVRAARLLLRRCPLWGDATCLQLAMQADARAFFAQDGVQSLLTQKWWGDMASTTPIWALVLAFFCP
PLIYTRLITFRKSEEEPTREELEFDMDSVINGEGPVGTADPAEKTPLGVPRQSGRPGCCGGRCGGRRCLR
RWFHFWGAPVTIFMGNVVSYLLFLLLFSRVLLVDFQPAPPGSLELLLYFWAFTLLCEELRQGLSGGGGSL
ASGGPGPGHASLSQRLRLYLADSWNQCDLVALTCFLLGVGCRLTPGLYHLGRTVLCIDFMVFTVRLLHIF
TVNKQLGPKIVIVSKMMKDVFFFLFFLGVWLVAYGVATEGLLRPRDSDFPSILRRVFYRPYLQIFGQIPQ
EDMDVALMEHSNCSSEPGFWAHPPGAQAGTCVSQYANWLVVLLLVIFLLVANILLVNLLIAMFSYTFGKV
QGNSDLYWKAQRYRLIREFHSRPALAPPFIVISHLRLLLRQLCRRPRSPQPSSPALEHFRVYLSKEAERK
LLTWESVHKENFLLARARDKRESDSERLKRTSQKVDLALKQLGHIREYEQRLKVLEREVQQCSRVLGWVA
EALSRSALLPPGGPPPPDLPGSKD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_017636
ORF Size 3642 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_017636.4
RefSeq Size 4061 bp
RefSeq ORF 3645 bp
Locus ID 54795
UniProt ID Q8TD43
Cytogenetics 19q13.33
Protein Families Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane
MW 134.1 kDa
Gene Summary The protein encoded by this gene is a calcium-activated nonselective ion channel that mediates transport of monovalent cations across membranes, thereby depolarizing the membrane. The activity of the encoded protein increases with increasing intracellular calcium concentration, but this channel does not transport calcium. [provided by RefSeq, Mar 2016]

Other Versions

Other products for "TRPM4"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00


TRPM4 mouse monoclonal antibody, clone OTI10H5 (formerly 10H5)
    • 100 ul

USD 446.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.