NUMBL (NM_004756) Human Tagged ORF Clone

CAT#: RC216869

Reviews ()
Write a review

NUMBL (Myc-DDK-tagged)-Human numb homolog (Drosophila)-like (NUMBL)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 544.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NUMBL
Synonyms CAG3A; CTG3a; NBL; NUMB-R; NUMBLIKE; NUMBR; TNRC23
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC216869 representing NM_004756
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCCGCAGCGCGGCGGCCAGCGGCGGACCCCGGAGGCCTGAGCGGCACCTGCCCCCAGCCCCCTGTG
GGGCCCCGGGGCCCCCAGAAACCTGCAGGACGGAGCCAGACGGGGCGGGCACCATGAACAAGTTACGGCA
GAGCCTGCGGCGGAGGAAGCCAGCCTACGTGCCCGAGGCGTCGCGCCCGCACCAGTGGCAGGCAGACGAG
GACGCGGTGCGGAAGGGCACGTGCAGCTTCCCGGTCAGGTACCTGGGTCACGTGGAGGTAGAGGAGTCCC
GGGGAATGCACGTGTGTGAAGATGCGGTGAAGAAGCTGAAGGCGATGGGCCGAAAGTCCGTGAAGTCTGT
CCTGTGGGTGTCAGCCGATGGGCTCCGAGTGGTGGACGACAAAACCAAGGATCTTCTGGTCGACCAGACC
ATCGAAAAGGTCTCCTTTTGTGCTCCTGACCGCAACCTGGACAAGGCTTTCTCCTATATCTGTCGTGACG
GGACTACCCGCCGCTGGATCTGCCACTGTTTTCTGGCACTGAAGGACTCCGGCGAGAGGCTGAGCCACGC
TGTGGGCTGTGCTTTTGCCGCCTGCCTGGAGCGAAAACAGCGACGGGAGAAGGAATGTGGGGTCACGGCC
GCCTTCGATGCCAGCCGCACCAGCTTCGCCCGCGAGGGCTCCTTCCGCCTGTCTGGGGGTGGGCGGCCTG
CTGAGCGAGAGGCCCCGGACAAGAAGAAAGCAGAGGCAGCAGCTGCCCCCACTGTGGCTCCTGGCCCTGC
CCAGCCTGGGCACGTGTCCCCGACACCAGCCACCACATCCCCTGGTGAGAAGGGTGAGGCAGGCACCCCT
GTGGCTGCAGGCACCACTGCGGCCGCCATCCCCCGGCGCCATGCACCCCTGGAGCAGCTGGTTCGCCAGG
GCTCCTTCCGTGGGTTCCCAGCACTCAGCCAGAAGAACTCGCCTTTCAAACGGCAGCTGAGCCTACGGCT
GAATGAGCTGCCATCCACGCTGCAGCGCCGCACTGACTTCCAGGTGAAGGGCACAGTGCCTGAGATGGAG
CCTCCTGGTGCCGGCGACAGTGACAGCATCAACGCTCTGTGCACACAGATCAGTTCATCTTTTGCCAGTG
CTGGAGCGCCAGCACCAGGGCCACCACCTGCCACAACAGGGACTTCTGCCTGGGGTGAGCCCTCCGTGCC
CCCTGCAGCTGCCTTCCAGCCTGGGCACAAGCGGACACCTTCAGAGGCTGAGCGATGGCTGGAGGAGGTG
TCACAGGTGGCCAAGGCCCAGCAGCAGCAGCAGCAGCAACAGCAACAGCAGCAGCAGCAGCAGCAGCAAC
AGCAGCAAGCAGCCTCAGTGGCCCCAGTGCCCACCATGCCTCCTGCCCTGCAGCCTTTCCCCGCCCCCGT
GGGGCCCTTTGACGCTGCACCTGCCCAAGTGGCCGTGTTCCTGCCACCCCCACACATGCAGCCCCCTTTT
GTGCCCGCCTACCCGGGCTTGGGCTACCCACCGATGCCCCGGGTGCCCGTGGTGGGCATCACACCCTCAC
AGATGGTGGCAAACGCCTTCTGCTCAGCCGCCCAGCTCCAGCCTCAGCCTGCCACTCTGCTTGGGAAAGC
TGGGGCCTTCCCGCCCCCTGCCATACCCAGTGCCCCTGGGAGCCAGGCCCGCCCTCGCCCCAATGGGGCC
CCCTGGCCCCCTGAGCCAGCGCCTGCCCCAGCTCCAGAGTTGGACCCCTTTGAGGCCCAGTGGGCGGCAT
TAGAAGGCAAAGCCACTGTAGAGAAACCCTCCAACCCCTTTTCTGGCGACCTGCAAAAGACATTCGAGAT
TGAACTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC216869 representing NM_004756
Red=Cloning site Green=Tags(s)

MSRSAAASGGPRRPERHLPPAPCGAPGPPETCRTEPDGAGTMNKLRQSLRRRKPAYVPEASRPHQWQADE
DAVRKGTCSFPVRYLGHVEVEESRGMHVCEDAVKKLKAMGRKSVKSVLWVSADGLRVVDDKTKDLLVDQT
IEKVSFCAPDRNLDKAFSYICRDGTTRRWICHCFLALKDSGERLSHAVGCAFAACLERKQRREKECGVTA
AFDASRTSFAREGSFRLSGGGRPAEREAPDKKKAEAAAAPTVAPGPAQPGHVSPTPATTSPGEKGEAGTP
VAAGTTAAAIPRRHAPLEQLVRQGSFRGFPALSQKNSPFKRQLSLRLNELPSTLQRRTDFQVKGTVPEME
PPGAGDSDSINALCTQISSSFASAGAPAPGPPPATTGTSAWGEPSVPPAAAFQPGHKRTPSEAERWLEEV
SQVAKAQQQQQQQQQQQQQQQQQQQQAASVAPVPTMPPALQPFPAPVGPFDAAPAQVAVFLPPPHMQPPF
VPAYPGLGYPPMPRVPVVGITPSQMVANAFCSAAQLQPQPATLLGKAGAFPPPAIPSAPGSQARPRPNGA
PWPPEPAPAPAPELDPFEAQWAALEGKATVEKPSNPFSGDLQKTFEIEL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004756
ORF Size 1827 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004756.5
RefSeq Size 3568 bp
RefSeq ORF 1830 bp
Locus ID 9253
UniProt ID Q9Y6R0
Cytogenetics 19q13.2
Domains PID
Protein Pathways Notch signaling pathway
MW 64.9 kDa
Gene Summary Plays a role in the process of neurogenesis. Required throughout embryonic neurogenesis to maintain neural progenitor cells, also called radial glial cells (RGCs), by allowing their daughter cells to choose progenitor over neuronal cell fate. Not required for the proliferation of neural progenitor cells before the onset of embryonic neurogenesis. Also required postnatally in the subventricular zone (SVZ) neurogenesis by regulating SVZ neuroblasts survival and ependymal wall integrity. Negative regulator of NF-kappa-B signaling pathway. The inhibition of NF-kappa-B activation is mediated at least in part, by preventing MAP3K7IP2 to interact with polyubiquitin chains of TRAF6 and RIPK1 and by stimulating the 'Lys-48'-linked polyubiquitination and degradation of TRAF6 in cortical neurons.[UniProtKB/Swiss-Prot Function]
Other products for "NUMBL"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.