ATG16L1 (NM_030803) Human Tagged ORF Clone

CAT#: RC216728

Reviews ()
Write a review

ATG16L1 (Myc-DDK-tagged)-Human ATG16 autophagy related 16-like 1 (S. cerevisiae) (ATG16L1), transcript variant 1



  "NM_030803" in other vectors (6)

USD 560.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ATG16L1 (NM_030803) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ATG16L1
Synonyms APG16L; ATG16A; ATG16L; IBD10; WDR30
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC216728 representing NM_030803
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGTCGGGCCTCCGCGCCGCTGACTTCCCCCGCTGGAAGCGCCACATCTCGGAGCAACTGAGGCGCC
GGGACCGGCTGCAGAGACAGGCGTTCGAGGAGATCATCCTGCAGTATAACAAATTGCTGGAAAAGTCAGA
TCTTCATTCAGTGTTGGCCCAGAAACTACAGGCTGAAAAGCATGACGTACCAAACAGGCACGAGATAAGT
CCCGGACATGATGGCACATGGAATGACAATCAGCTACAAGAAATGGCCCAACTGAGGATTAAGCACCAAG
AGGAACTGACTGAATTACACAAGAAACGTGGGGAGTTAGCTCAACTGGTGATTGACCTGAATAACCAAAT
GCAGCGGAAGGACAGGGAGATGCAGATGAATGAAGCAAAAATTGCAGAATGTTTGCAGACTATCTCTGAC
CTGGAGACGGAGTGCCTAGACCTGCGCACTAAGCTTTGTGACCTTGAAAGAGCCAACCAGACCCTGAAGG
ATGAATATGATGCCCTGCAGATCACTTTTACTGCCTTGGAGGGAAAACTGAGGAAAACTACGGAAGAGAA
CCAGGAGCTGGTCACCAGATGGATGGCTGAGAAAGCCCAGGAAGCCAATCGGCTTAATGCAGAGAATGAA
AAAGACTCCAGGAGGCGGCAAGCCCGGCTGCAGAAAGAGCTTGCAGAAGCAGCAAAGGAACCTCTACCAG
TCGAACAGGATGATGACATTGAGGTCATTGTGGATGAAACTTCTGATCACACAGAAGAGACCTCTCCTGT
GCGAGCCATCAGCAGAGCAGCCACTAAGCGACTCTCGCAGCCTGCTGGAGGCCTTCTGGATTCTATCACT
AATATCTTTGGGAGACGCTCTGTCTCTTCCTTCCCAGTCCCCCAGGACAATGTGGATACTCATCCTGGTT
CTGGTAAAGAAGTGAGGGTACCAGCTACTGCCTTGTGTGTCTTCGATGCACATGATGGGGAAGTCAACGC
TGTGCAGTTCAGTCCAGGTTCCCGGTTACTGGCCACTGGAGGCATGGACCGCAGGGTTAAGCTTTGGGAA
GTATTTGGAGAAAAATGTGAGTTCAAGGGTTCCCTATCTGGCAGTAATGCAGGAATTACAAGCATTGAAT
TTGATAGTGCTGGATCTTACCTCTTAGCAGCTTCAAATGATTTTGCAAGCCGAATCTGGACTGTGGATGA
TTATCGATTACGGCACACACTCACGGGACACAGTGGGAAAGTGCTGTCTGCTAAGTTCCTGCTGGACAAT
GCGCGGATTGTCTCAGGAAGTCACGACCGGACTCTCAAACTCTGGGATCTACGCAGCAAAGTCTGCATAA
AGACAGTGTTTGCAGGATCCAGTTGCAATGATATTGTCTGCACAGAGCAATGTGTAATGAGTGGACATTT
TGACAAGAAAATTCGTTTCTGGGACATTCGATCAGAGAGCATAGTTCGAGAGATGGAGCTGTTGGGAAAG
ATTACTGCCCTGGACTTAAACCCAGAAAGGACTGAGCTCCTGAGCTGCTCCCGTGATGACTTGCTAAAAG
TTATTGATCTCCGAACAAATGCTATCAAGCAGACATTCAGTGCACCTGGGTTCAAGTGCGGCTCTGACTG
GACCAGAGTTGTCTTCAGCCCTGATGGCAGTTACGTGGCGGCAGGCTCTGCTGAGGGCTCTCTGTATATC
TGGAGTGTGCTCACAGGGAAAGTGGAAAAGGTTCTTTCAAAGCAGCACAGCTCATCCATCAATGCGGTGG
CGTGGTCGCCCTCTGGCTCGCACGTTGTCAGTGTGGACAAAGGATGCAAAGCTGTGCTGTGGGCACAGTA
C


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC216728 representing NM_030803
Red=Cloning site Green=Tags(s)

MSSGLRAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEIS
PGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISD
LETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENE
KDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSIT
NIFGRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWE
VFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDN
ARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGK
ITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYI
WSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_030803
ORF Size 1821 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_030803.6, NP_110430.5
RefSeq Size 3411 bp
RefSeq ORF 1824 bp
Locus ID 55054
Cytogenetics 2q37.1
Domains WD40
MW 68.1 kDa
Gene Summary The protein encoded by this gene is part of a large protein complex that is necessary for autophagy, the major process by which intracellular components are targeted to lysosomes for degradation. Defects in this gene are a cause of susceptibility to inflammatory bowel disease type 10 (IBD10). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]

Citations (1)

Other Versions

Other products for "ATG16L1"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


ATG16L1 mouse monoclonal antibody,clone OTI5A2
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools