ITGA11 (NM_001004439) Human Tagged ORF Clone

CAT#: RC216722

Reviews ()
Write a review

ITGA11 (Myc-DDK-tagged)-Human integrin, alpha 11 (ITGA11)



Reconstitution Protocol

USD 1,034.00

In Stock*

Size
    • 10 ug

Product images

Other products for "ITGA11"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ITGA11
Synonyms HsT18964
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC216722 representing NM_001004439
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCTGCCCAGGGGCCTGGTGGTGGCCTGGGCGCTCAGCCTGTGGCCAGGGTTCACGGACACCTTCA
ACATGGACACCAGGAAGCCCCGGGTCATCCCTGGCTCCAGGACCGCCTTCTTTGGCTACACAGTGCAGCA
GCACGACATCAGTGGCAATAAGTGGCTGGTCGTGGGCGCCCCACTGGAAACCAATGGCTACCAGAAGACG
GGAGACGTGTACAAGTGTCCAGTGATCCACGGGAACTGCACCAAACTCAACCTGGGAAGGGTCACCCTGT
CCAACGTGTCCGAGCGGAAAGACAACATGCGCCTCGGCCTTAGTCTCGCCACCAACCCCAAGGACAACAG
CTTCCTGGCCTGCAGCCCCCTCTGGTCTCATGAGTGTGGGAGCTCCTACTACACCACAGGGATGTGTTCA
AGAGTCAACTCCAACTTCAGGTTCTCCAAGACCGTGGCCCCAGCTCTCCAAAGGTGCCAGACCTACATGG
ACATCGTCATTGTCCTGGATGGCTCCAACAGCATCTACCCCTGGGTGGAGGTTCAGCACTTCCTCATCAA
CATCCTGAAAAAGTTTTACATTGGCCCAGGGCAGATCCAGGTTGGAGTTGTGCAGTATGGCGAAGATGTG
GTGCATGAGTTTCACCTCAACGACTACAGGTCTGTAAAAGATGTGGTGGAAGCTGCCAGCCACATTGAGC
AGAGAGGAGGAACAGAGACCCGGACGGCATTTGGCATTGAATTTGCACGCTCAGAGGCTTTCCAGAAGGG
TGGAAGGAAAGGAGCCAAGAAGGTGATGATTGTCATCACAGATGGGGAGTCCCACGACAGCCCAGACCTG
GAGAAGGTGATCCAGCAAAGCGAAAGAGACAACGTAACAAGATATGCGGTGGCCGTCCTGGGCTACTACA
ACCGCAGGGGGATCAATCCAGAAACTTTTCTAAATGAAATCAAATACATCGCCAGTGACCCTGATGACAA
GCACTTCTTCAATGTCACTGATGAGGCTGCCTTGAAGGACATTGTCGATGCCCTGGGGGACAGAATCTTC
AGCCTGGAAGGCACCAACAAGAACGAGACCTCCTTTGGGCTGGAGATGTCACAGACGGGCTTTTCCTCGC
ACGTGGTGGAGGATGGGGTTCTGCTGGGAGCCGTCGGTGCCTATGACTGGAATGGAGCTGTGCTAAAGGA
GACGAGTGCCGGGAAGGTCATTCCTCTCCGCGAGTCCTACCTGAAAGAGTTCCCCGAGGAGCTCAAGAAC
CATGGTGCATACCTGGGGTACACAGTCACATCGGTCGTGTCCTCCAGGCAGGGGCGGGTGTACGTGGCCG
GAGCCCCCCGGTTCAACCACACGGGCAAGGTCATCCTGTTCACCATGCACAACAACCGGAGCCTCACCAT
CCACCAGGCTATGCGGGGCCAGCAGATAGGCTCTTACTTTGGGAGTGAAATCACCTCGGTGGACATCGAC
GGCGACGGCGTGACTGATGTCCTGCTGGTGGGCGCACCCATGTACTTCAACGAGGGCCGTGAGCGAGGCA
AGGTGTACGTCTATGAGCTGAGACAGAACCTGTTTGTTTATAACGGAACGCTAAAGGATTCACACAGTTA
CCAGAATGCCCGATTTGGGTCCTCCATTGCCTCAGTTCGAGACCTCAACCAGGATTCCTACAATGACGTG
GTGGTGGGAGCCCCCCTGGAGGACAACCACGCAGGAGCCATCTACATCTTCCACGGCTTCCGAGGCAGCA
TCCTGAAGACACCTAAGCAGAGAATCACAGCCTCAGAGCTGGCTACCGGCCTCCAGTATTTTGGCTGCAG
CATCCACGGGCAATTGGACCTCAATGAGGATGGGCTCATCGACCTGGCAGTGGGAGCCCTTGGCAACGCT
GTGATTCTGTGGTCCCGCCCAGTGGTTCAGATCAATGCCAGCCTCCACTTTGAGCCATCCAAGATCAACA
TCTTCCACAGAGACTGCAAGCGCAGTGGCAGGGATGCCACCTGCCTGGCCGCCTTCCTCTGCTTCACGCC
CATCTTCCTGGCACCCCATTTCCAAACAACAACTGTTGGCATCAGATACAACGCCACCATGGATGAGAGG
CGGTATACACCGAGGGCCCACCTGGACGAGGGCGGGGACCGATTCACCAACAGAGCCGTACTGCTCTCCT
CCGGCCAGGAGCTCTGTGAGCGGATCAACTTCCATGTCCTGGACACTGCTGACTACGTGAAGCCAGTGAC
CTTCTCAGTCGAGTATTCCCTGGAGGACCCTGACCATGGCCCCATGCTGGACGACGGCTGGCCCACCACT
CTCAGAGTCTCGGTGCCCTTCTGGAACGGCTGCAATGAGGATGAGCACTGTGTCCCTGACCTTGTGTTGG
ATGCCCGGAGTGACCTGCCCACGGCCATGGAGTACTGCCAGAGGGTGCTGAGGAAGCCTGCGCAGGACTG
CTCCGCATACACGCTGTCCTTCGACACCACAGTCTTCATCATAGAGAGCACACGCCAGCGAGTGGCGGTG
GAGGCCACACTGGAGAACAGGGGCGAGAACGCCTACAGCACGGTCCTAAATATCTCGCAGTCAGCAAACC
TGCAGTTTGCCAGCTTGATCCAGAAGGAGGACTCAGACGGTAGCATTGAGTGTGTGAACGAGGAGAGGAG
GCTCCAGAAGCAAGTCTGCAACGTCAGCTATCCCTTCTTCCGGGCCAAGGCCAAGGTGGCTTTCCGTCTT
GATTTTGAGTTCAGCAAATCCATCTTCCTACACCACCTGGAGATCGAGCTCGCTGCAGGCAGTGACAGTA
ATGAGCGGGACAGCACCAAGGAAGACAACGTGGCCCCCTTACGCTTCCACCTCAAATACGAGGCTGACGT
CCTCTTCACCAGGAGCAGCAGCCTGAGCCACTACGAGGTCAAGCCCAACAGCTCGCTGGAGAGATACGAT
GGTATCGGGCCTCCCTTCAGCTGCATCTTCAGGATCCAGAACTTGGGCTTGTTCCCCATCCACGGGATGA
TGATGAAGATCACCATTCCCATCGCCACCAGGAGCGGCAACCGCCTACTGAAGCTGAGGGACTTCCTCAC
GGACGAGGCGAACACGTCCTGTAACATCTGGGGCAATAGCACTGAGTACCGGCCCACCCCAGTGGAGGAA
GACTTGCGTCGTGCTCCACAGCTGAATCACAGCAACTCTGATGTCGTCTCCATCAACTGCAATATACGGC
TGGTCCCCAACCAGGAAATCAATTTCCATCTACTGGGGAACCTGTGGTTGAGGTCCCTAAAAGCACTCAA
GTACAAATCCATGAAAATCATGGTCAACGCAGCCTTGCAGAGGCAGTTCCACAGCCCCTTCATCTTCCGT
GAGGAGGATCCCAGCCGCCAGATCGTGTTTGAGATCTCCAAGCAAGAGGACTGGCAGGTCCCCATCTGGA
TCATTGTAGGCAGCACCCTGGGGGGCCTCCTACTGCTGGCCCTGCTGGTCCTGGCACTGTGGAAGCTCGG
CTTCTTTAGAAGTGCCAGGCGCAGGAGGGAGCCTGGTCTGGACCCCACCCCCAAAGTGCTGGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC216722 representing NM_001004439
Red=Cloning site Green=Tags(s)

MDLPRGLVVAWALSLWPGFTDTFNMDTRKPRVIPGSRTAFFGYTVQQHDISGNKWLVVGAPLETNGYQKT
GDVYKCPVIHGNCTKLNLGRVTLSNVSERKDNMRLGLSLATNPKDNSFLACSPLWSHECGSSYYTTGMCS
RVNSNFRFSKTVAPALQRCQTYMDIVIVLDGSNSIYPWVEVQHFLINILKKFYIGPGQIQVGVVQYGEDV
VHEFHLNDYRSVKDVVEAASHIEQRGGTETRTAFGIEFARSEAFQKGGRKGAKKVMIVITDGESHDSPDL
EKVIQQSERDNVTRYAVAVLGYYNRRGINPETFLNEIKYIASDPDDKHFFNVTDEAALKDIVDALGDRIF
SLEGTNKNETSFGLEMSQTGFSSHVVEDGVLLGAVGAYDWNGAVLKETSAGKVIPLRESYLKEFPEELKN
HGAYLGYTVTSVVSSRQGRVYVAGAPRFNHTGKVILFTMHNNRSLTIHQAMRGQQIGSYFGSEITSVDID
GDGVTDVLLVGAPMYFNEGRERGKVYVYELRQNLFVYNGTLKDSHSYQNARFGSSIASVRDLNQDSYNDV
VVGAPLEDNHAGAIYIFHGFRGSILKTPKQRITASELATGLQYFGCSIHGQLDLNEDGLIDLAVGALGNA
VILWSRPVVQINASLHFEPSKINIFHRDCKRSGRDATCLAAFLCFTPIFLAPHFQTTTVGIRYNATMDER
RYTPRAHLDEGGDRFTNRAVLLSSGQELCERINFHVLDTADYVKPVTFSVEYSLEDPDHGPMLDDGWPTT
LRVSVPFWNGCNEDEHCVPDLVLDARSDLPTAMEYCQRVLRKPAQDCSAYTLSFDTTVFIIESTRQRVAV
EATLENRGENAYSTVLNISQSANLQFASLIQKEDSDGSIECVNEERRLQKQVCNVSYPFFRAKAKVAFRL
DFEFSKSIFLHHLEIELAAGSDSNERDSTKEDNVAPLRFHLKYEADVLFTRSSSLSHYEVKPNSSLERYD
GIGPPFSCIFRIQNLGLFPIHGMMMKITIPIATRSGNRLLKLRDFLTDEANTSCNIWGNSTEYRPTPVEE
DLRRAPQLNHSNSDVVSINCNIRLVPNQEINFHLLGNLWLRSLKALKYKSMKIMVNAALQRQFHSPFIFR
EEDPSRQIVFEISKQEDWQVPIWIIVGSTLGGLLLLALLVLALWKLGFFRSARRRREPGLDPTPKVLE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001004439
ORF Size 3564 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001004439.2
RefSeq Size 5035 bp
RefSeq ORF 3567 bp
Locus ID 22801
UniProt ID Q9UKX5
Cytogenetics 15q23
Protein Families Druggable Genome, Transmembrane
Protein Pathways Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, ECM-receptor interaction, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Regulation of actin cytoskeleton
MW 133.47 kDa
Gene Summary This gene encodes an alpha integrin. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This protein contains an I domain, is expressed in muscle tissue, dimerizes with beta 1 integrin in vitro, and appears to bind collagen in this form. Therefore, the protein may be involved in attaching muscle tissue to the extracellular matrix. Alternative transcriptional splice variants have been found for this gene, but their biological validity is not determined. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.