CDK5RAP1 (NM_016408) Human Tagged ORF Clone

CAT#: RC216600

CDK5RAP1 (Myc-DDK-tagged)-Human CDK5 regulatory subunit associated protein 1 (CDK5RAP1), transcript variant 1

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CDK5RAP1 (NM_016408) Human Tagged ORF Clone
Symbol CDK5RAP1
Synonyms C20orf34; C42; CGI-05; HSPC167
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC216600 representing NM_016408
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCACCCTTTACAGTGTGTCCTCCAAGTGCAGAGGTCTCTGGGGTGGGGACCATTGGCCTCTGTGTCTT
GGCTGTCGCTGAGGATGTGCAGGGCACACAGCAGTCTCTCTAGTACCATGTGTCCCAGTCCAGAGAGGCA
GGAGGATGGAGCTCGGAAGGATTTCAGCTCCAGGCTGGCTGCTGGACCGACTTTTCAACATTTTTTAAAA
AGTGCCTCAGCTCCTCAGGAGAAGCTGTCTTCAGAAGTGGAAGACCCACCTCCCTATCTCATGATGGATG
AACTTCTTGGAAGGCAGAGAAAAGTCTACCTCGAGACCTATGGCTGCCAGATGAATGTGAATGACACAGA
GATAGCCTGGTCCATCTTACAGAAGAGTGGCTACCTGCGGACCAGTAACCTCCAAGAGGCAGATGTGATT
CTCCTTGTCACGTGCTCTATCAGGGAGAAGGCTGAGCAGACCATCTGGAACCGTTTACATCAGCTTAAAG
CCTTGAAGACAAGGCGGCCCCGCTCCCGGGTTCCTCTGAGGATTGGAATTCTAGGCTGCATGGCTGAGAG
GTTGAAGGAGGAGATTCTCAACAGAGAGAAAATGGTAGATATTTTGGCTGGTCCTGATGCCTACCGGGAC
CTTCCCCGGCTGCTGGCTGTTGCTGAGTCGGGCCAGCAAGCTGCCAACGTGCTGCTCTCTCTGGACGAGA
CCTATGCTGATGTCATGCCAGTCCAGACAAGCGCCAGTGCCACGTCTGCCTTTGTGTCAATCATGCGAGG
CTGTGACAACATGTGTAGCTACTGCATTGTTCCTTTCACCCGGGGCAGGGAGAGGAGTCGGCCTATTGCC
TCCATTCTAGAGGAAGTGAAGAAGCTTTCTGAGCAGGGGCTGAAAGAAGTGACACTTCTTGGTCAGAATG
TTAATAGTTTTCGGGACAATTCGGAGGTCCAGTTCAACAGTGCAGTGCCTACCAATCTCAGTCGTGGCTT
TACCACCAACTATAAAACCAAGCAAGGAGGACTTCGTTTTGCTCATCTTCTGGATCAGGTCTCCAGAGTA
GATCCTGAAATGAGGATCCGTTTTACCTCTCCCCACCCCAAGGATTTTCCTGATGAGGTTCTGCAGCTGA
TTCATGAGAGAGATAACATCTGTAAACAGATCCACCTGCCAGCCCAGAGTGGAAGCAGCCGTGTGTTGGA
GGCCATGCGGAGGGGATATTCAAGAGAAGCTTATGTGGAGTTAGTTCACCATATTAGAGAATCTATTCCA
GGTGTGAGCCTCAGCAGCGATTTCATTGCTGGCTTTTGTGGTGAGACGGAGGAAGATCACGTCCAGACAG
TCTCTTTGCTCCGGGAAGTTCAGTACAACATGGGCTTCCTCTTTGCCTACAGCATGAGACAGAAGACACG
GGCATATCATAGGCTGAAGGATGATGTCCCGGAAGAGGTAAAATTAAGGCGTTTGGAGGAACTCATCACT
ATCTTCCGAGAAGAAGCAACAAAAGCCAATCAGACCTCTGTGGGCTGTACCCAGTTGGTGCTAGTGGAAG
GGCTCAGTAAACGCTCTGCCACTGACCTGTGTGGCAGGAATGATGGAAACCTTAAGGTGATCTTCCCTGA
TGCAGAGATGGAGGATGTCAATAACCCTGGGCTCAGGGTCAGAGCCCAGCCTGGGGACTATGTGCTGGTG
AAGATCACCTCAGCCAGTTCTCAGACACTTAGGGGACATGTTCTCTGCAGGACCACTCTGAGGGACTCTT
CTGCATATTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC216600 representing NM_016408
Red=Cloning site Green=Tags(s)

MHPLQCVLQVQRSLGWGPLASVSWLSLRMCRAHSSLSSTMCPSPERQEDGARKDFSSRLAAGPTFQHFLK
SASAPQEKLSSEVEDPPPYLMMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVI
LLVTCSIREKAEQTIWNRLHQLKALKTRRPRSRVPLRIGILGCMAERLKEEILNREKMVDILAGPDAYRD
LPRLLAVAESGQQAANVLLSLDETYADVMPVQTSASATSAFVSIMRGCDNMCSYCIVPFTRGRERSRPIA
SILEEVKKLSEQGLKEVTLLGQNVNSFRDNSEVQFNSAVPTNLSRGFTTNYKTKQGGLRFAHLLDQVSRV
DPEMRIRFTSPHPKDFPDEVLQLIHERDNICKQIHLPAQSGSSRVLEAMRRGYSREAYVELVHHIRESIP
GVSLSSDFIAGFCGETEEDHVQTVSLLREVQYNMGFLFAYSMRQKTRAYHRLKDDVPEEVKLRRLEELIT
IFREEATKANQTSVGCTQLVLVEGLSKRSATDLCGRNDGNLKVIFPDAEMEDVNNPGLRVRAQPGDYVLV
KITSASSQTLRGHVLCRTTLRDSSAYC

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_016408
ORF Size 1761 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_016408.1, NM_016408.2, NM_016408.3, NP_057492
RefSeq Size 2104
RefSeq ORF 1764
Locus ID 51654
Cytogenetics 20q11.21
Domains TRAM, UPF0004, Elp3, Radical_SAM
MW 66 kDa
Gene Summary This gene encodes a regulator of cyclin-dependent kinase 5 activity. This protein has also been reported to modify RNA by adding a methylthio-group and may thus have a dual function as an RNA methylthiotransferase and as an inhibitor of cyclin-dependent kinase 5 activity. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, May 2013].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)