TGF beta Receptor III (TGFBR3) (NM_003243) Human Tagged ORF Clone

CAT#: RC216595

Reviews ()
Write a review

TGFBR3 (Myc-DDK-tagged)-Human transforming growth factor, beta receptor III (TGFBR3), transcript variant 1



  "NM_003243" in other vectors (6)

Reconstitution Protocol

USD 1,168.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "TGFBR3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TGFBR3
Synonyms betaglycan; BGCAN
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC216595 representing NM_003243
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTTCCCATTATGTGATTGCCATCTTTGCCCTGATGAGCTCCTGTTTAGCCACTGCAGGTCCAGAGC
CTGGTGCACTGTGTGAACTGTCACCTGTCAGTGCCTCCCATCCTGTCCAGGCCTTGATGGAGAGCTTCAC
TGTTTTGTCAGGCTGTGCCAGCAGAGGCACAACTGGGCTGCCACAGGAGGTGCATGTCCTGAATCTCCGC
ACTGCAGGCCAGGGGCCTGGCCAGCTACAGAGAGAGGTCACACTTCACCTGAATCCCATCTCCTCAGTCC
ACATCCACCACAAGTCTGTTGTGTTCCTGCTCAACTCCCCACACCCCCTGGTGTGGCATCTGAAGACAGA
GAGACTTGCCACTGGGGTCTCCAGACTGTTTTTGGTGTCTGAGGGTTCTGTGGTCCAGTTTTCATCAGCA
AACTTCTCCTTGACAGCAGAAACAGAAGAAAGGAACTTCCCCCATGGAAATGAACATCTGTTAAATTGGG
CCCGAAAAGAGTATGGAGCAGTTACTTCATTCACCGAACTCAAGATAGCAAGAAACATTTATATTAAAGT
GGGGGAAGATCAAGTGTTCCCTCCAAAGTGCAACATAGGGAAGAATTTTCTCTCACTCAATTACCTTGCT
GAGTACCTTCAACCCAAAGCAGCAGAAGGGTGTGTGATGTCCAGCCAGCCCCAGAATGAGGAAGTACACA
TCATCGAGCTAATCACCCCCAACTCTAACCCCTACAGTGCTTTCCAGGTGGATATAACAATTGATATAAG
ACCTTCTCAAGAGGATCTTGAAGTGGTCAAAAATCTCATCCTGATCTTGAAGTGCAAAAAGTCTGTCAAC
TGGGTGATCAAATCTTTTGATGTTAAGGGAAGCCTGAAAATTATTGCTCCTAACAGTATTGGCTTTGGAA
AAGAGAGTGAAAGATCTATGACAATGACCAAATCAATAAGAGATGACATTCCTTCAACCCAAGGGAATCT
GGTGAAGTGGGCTTTGGACAATGGCTATAGTCCAATAACTTCATACACAATGGCTCCTGTGGCTAATAGA
TTTCATCTTCGGCTTGAAAATAATGCAGAGGAGATGGGAGATGAGGAAGTCCACACTATTCCTCCTGAGC
TACGGATCCTGCTGGACCCTGGTGCCCTGCCTGCCCTGCAGAACCCGCCCATCCGGGGAGGGGAAGGCCA
AAATGGAGGCCTTCCGTTTCCTTTCCCAGATATTTCCAGGAGAGTCTGGAATGAAGAGGGAGAAGATGGG
CTCCCTCGGCCAAAGGACCCTGTCATTCCCAGCATACAACTGTTTCCTGGTCTCAGAGAGCCAGAAGAGG
TGCAAGGGAGCGTGGATATTGCCCTGTCTGTCAAATGTGACAATGAGAAGATGATCGTGGCTGTAGAAAA
AGATTCTTTTCAGGCCAGTGGCTACTCGGGGATGGACGTCACCCTGTTGGATCCTACCTGCAAGGCCAAG
ATGAATGGCACACACTTTGTTTTGGAGTCTCCTCTGAATGGCTGCGGTACTCGGCCCCGGTGGTCAGCCC
TTGATGGTGTGGTCTACTATAACTCCATTGTGATACAGGTTCCAGCCCTTGGGGACAGTAGTGGTTGGCC
AGATGGTTATGAAGATCTGGAGTCAGGTGATAATGGATTTCCGGGAGATATGGATGAAGGAGATGCTTCC
CTGTTCACCCGACCTGAAATCGTGGTGTTTAATTGCAGCCTTCAGCAGGTGAGGAACCCCAGCAGCTTCC
AGGAACAGCCCCACGGAAACATCACCTTCAACATGGAGCTATACAACACTGACCTCTTTTTGGTGCCCTC
CCAGGGCGTCTTCTCTGTGCCAGAGAATGGACACGTTTATGTTGAGGTATCTGTTACTAAGGCTGAACAA
GAACTGGGATTTGCCATCCAAACGTGCTTTATCTCTCCATATTCGAACCCTGATAGGATGTCTCATTACA
CCATTATTGAGAATATTTGTCCTAAAGATGAATCTGTGAAATTCTACAGTCCCAAGAGAGTGCACTTTCC
TATCCCGCAAGCTGACATGGATAAGAAGCGATTCAGCTTTGTCTTCAAGCCTGTCTTCAACACCTCACTG
CTCTTTCTACAGTGTGAGCTGACGCTGTGTACGAAGATGGAGAAGCACCCCCAGAAGTTGCCTAAGTGTG
TGCCTCCTGACGAAGCCTGCACCTCGCTGGACGCCTCGATAATCTGGGCCATGATGCAGAATAAGAAGAC
GTTCACTAAGCCCCTTGCTGTGATCCACCATGAAGCAGAATCTAAAGAAAAAGGTCCAAGCATGAAGGAA
CCAAATCCAATTTCTCCACCAATTTTCCATGGTCTGGACACCCTAACCGTGATGGGCATTGCGTTTGCAG
CCTTTGTGATCGGAGCACTCCTGACGGGGGCCTTGTGGTACATCTATTCTCACACAGGGGAGACAGCAGG
AAGGCAGCAAGTCCCCACCTCCCCGCCAGCCTCGGAAAACAGCAGTGCTGCCCACAGCATCGGCAGCACG
CAGAGCACGCCTTGCTCCAGCAGCAGCACGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC216595 representing NM_003243
Red=Cloning site Green=Tags(s)

MTSHYVIAIFALMSSCLATAGPEPGALCELSPVSASHPVQALMESFTVLSGCASRGTTGLPQEVHVLNLR
TAGQGPGQLQREVTLHLNPISSVHIHHKSVVFLLNSPHPLVWHLKTERLATGVSRLFLVSEGSVVQFSSA
NFSLTAETEERNFPHGNEHLLNWARKEYGAVTSFTELKIARNIYIKVGEDQVFPPKCNIGKNFLSLNYLA
EYLQPKAAEGCVMSSQPQNEEVHIIELITPNSNPYSAFQVDITIDIRPSQEDLEVVKNLILILKCKKSVN
WVIKSFDVKGSLKIIAPNSIGFGKESERSMTMTKSIRDDIPSTQGNLVKWALDNGYSPITSYTMAPVANR
FHLRLENNAEEMGDEEVHTIPPELRILLDPGALPALQNPPIRGGEGQNGGLPFPFPDISRRVWNEEGEDG
LPRPKDPVIPSIQLFPGLREPEEVQGSVDIALSVKCDNEKMIVAVEKDSFQASGYSGMDVTLLDPTCKAK
MNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYEDLESGDNGFPGDMDEGDAS
LFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLFLVPSQGVFSVPENGHVYVEVSVTKAEQ
ELGFAIQTCFISPYSNPDRMSHYTIIENICPKDESVKFYSPKRVHFPIPQADMDKKRFSFVFKPVFNTSL
LFLQCELTLCTKMEKHPQKLPKCVPPDEACTSLDASIIWAMMQNKKTFTKPLAVIHHEAESKEKGPSMKE
PNPISPPIFHGLDTLTVMGIAFAAFVIGALLTGALWYIYSHTGETAGRQQVPTSPPASENSSAAHSIGST
QSTPCSSSSTA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003243
ORF Size 2553 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003243.5
RefSeq Size 4199 bp
RefSeq ORF 2556 bp
Locus ID 7049
UniProt ID Q03167
Cytogenetics 1p22.1
Domains zona_pellucida
Protein Families Druggable Genome, Secreted Protein, Transmembrane
MW 93.3 kDa
Gene Summary This locus encodes the transforming growth factor (TGF)-beta type III receptor. The encoded receptor is a membrane proteoglycan that often functions as a co-receptor with other TGF-beta receptor superfamily members. Ectodomain shedding produces soluble TGFBR3, which may inhibit TGFB signaling. Decreased expression of this receptor has been observed in various cancers. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.[provided by RefSeq, Sep 2010]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.