CYP11B1 (NM_000497) Human Tagged ORF Clone

CAT#: RC216551

Reviews ()
Write a review

CYP11B1 (Myc-DDK-tagged)-Human cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 1



  "NM_000497" in other vectors (6)

Reconstitution Protocol

USD 468.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "CYP11B1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CYP11B1
Synonyms CPN1; CYP11B; FHI; P450C11
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC216551 representing NM_000497
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCACTCAGGGCAAAGGCAGAGGTGTGCATGGCAGTGCCCTGGCTGTCCCTGCAAAGGGCACAGGCAC
TGGGCACGAGAGCCGCCCGGGTCCCCAGGACAGTGCTGCCCTTTGAAGCCATGCCCCGGCGTCCAGGCAA
CAGGTGGCTGAGGCTGCTGCAGATCTGGAGGGAGCAGGGTTATGAGGACCTGCACCTGGAAGTACACCAG
ACCTTCCAGGAACTAGGGCCCATTTTCAGGTACGACTTGGGAGGAGCAGGCATGGTGTGTGTGATGCTGC
CGGAGGACGTGGAGAAGCTGCAACAGGTGGACAGCCTGCATCCCCACAGGATGAGCCTGGAGCCCTGGGT
GGCCTACAGACAACATCGTGGGCACAAATGTGGCGTGTTCTTGCTGAATGGGCCTGAATGGCGCTTCAAC
CGATTGCGGCTGAATCCAGAAGTGCTGTCGCCCAACGCTGTGCAGAGGTTCCTCCCGATGGTGGATGCAG
TGGCCAGGGACTTCTCCCAGGCCCTGAAGAAGAAGGTGCTGCAGAACGCCCGGGGGAGCCTGACCCTGGA
CGTCCAGCCCAGCATCTTCCACTACACCATAGAAGCCAGCAACTTGGCTCTTTTTGGAGAGCGGCTGGGC
CTGGTTGGCCACAGCCCCAGTTCTGCCAGCCTGAACTTCCTCCATGCCCTGGAGGTCATGTTCAAATCCA
CCGTCCAGCTCATGTTCATGCCCAGGAGCCTGTCTCGCTGGACCAGCCCCAAGGTGTGGAAGGAGCACTT
TGAGGCCTGGGACTGCATCTTCCAGTACGGCGACAACTGTATCCAGAAAATCTATCAGGAACTGGCCTTC
AGCCGCCCTCAACAGTACACCAGCATCGTGGCAGAGCTCCTGTTGAATGCGGAACTGTCGCCAGATGCCA
TCAAGGCCAACTCTATGGAACTCACTGCAGGGAGCGTGGACACGACGGTGTTTCCCTTGCTGATGACGCT
CTTTGAGCTGGCTCGGAACCCCAACGTGCAGCAGGCCCTGCGCCAGGAGAGCCTGGCCGCCGCAGCCAGC
ATCAGTGAACATCCCCAGAAGGCAACCACCGAGCTGCCCTTGCTGCGTGCGGCCCTCAAGGAGACCTTGC
GGCTCTACCCTGTGGGTCTGTTTCTGGAGCGAGTGGCGAGCTCAGACTTGGTGCTTCAGAACTACCACAT
CCCAGCTGGGACATTGGTGCGCGTGTTCCTCTACTCTCTGGGTCGCAACCCCGCCTTGTTCCCGAGGCCT
GAGCGCTATAACCCCCAGCGCTGGCTAGACATCAGGGGCTCCGGCAGGAACTTCTACCACGTGCCCTTTG
GCTTTGGCATGCGCCAGTGCCTTGGGCGGCGCCTGGCAGAGGCAGAGATGCTGCTGCTGCTGCACCATGT
GCTGAAACACCTCCAGGTGGAGACACTAACCCAAGAGGACATAAAGATGGTCTACAGCTTCATATTGAGG
CCCAGCATGTTCCCCCTCCTCACCTTCAGAGCCATCAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC216551 representing NM_000497
Red=Cloning site Green=Tags(s)

MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQ
TFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFN
RLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLG
LVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAF
SRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAAS
ISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRP
ERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILR
PSMFPLLTFRAIN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000497
ORF Size 1509 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000497.4
RefSeq Size 3551 bp
RefSeq ORF 1512 bp
Locus ID 1584
UniProt ID P15538
Cytogenetics 8q24.3
Protein Families Druggable Genome, P450
Protein Pathways Androgen and estrogen metabolism, C21-Steroid hormone metabolism, Metabolic pathways
MW 57.57 kDa
Gene Summary This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and is involved in the conversion of progesterone to cortisol in the adrenal cortex. Mutations in this gene cause congenital adrenal hyperplasia due to 11-beta-hydroxylase deficiency. Transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Jul 2008]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.