CYP11B1(CYP11B1) (NM_000497) Human Tagged ORF Clone

CAT#: RC216551

CYP11B1 (Myc-DDK-tagged)-Human cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 1

Change vector?

USD 649


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CYP11B1(CYP11B1) (NM_000497) Human Tagged ORF Clone
Symbol CYP11B1
Synonyms CPN1; CYP11B; FHI; P450C11
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC216551 representing NM_000497
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCACTCAGGGCAAAGGCAGAGGTGTGCATGGCAGTGCCCTGGCTGTCCCTGCAAAGGGCACAGGCAC
TGGGCACGAGAGCCGCCCGGGTCCCCAGGACAGTGCTGCCCTTTGAAGCCATGCCCCGGCGTCCAGGCAA
CAGGTGGCTGAGGCTGCTGCAGATCTGGAGGGAGCAGGGTTATGAGGACCTGCACCTGGAAGTACACCAG
ACCTTCCAGGAACTAGGGCCCATTTTCAGGTACGACTTGGGAGGAGCAGGCATGGTGTGTGTGATGCTGC
CGGAGGACGTGGAGAAGCTGCAACAGGTGGACAGCCTGCATCCCCACAGGATGAGCCTGGAGCCCTGGGT
GGCCTACAGACAACATCGTGGGCACAAATGTGGCGTGTTCTTGCTGAATGGGCCTGAATGGCGCTTCAAC
CGATTGCGGCTGAATCCAGAAGTGCTGTCGCCCAACGCTGTGCAGAGGTTCCTCCCGATGGTGGATGCAG
TGGCCAGGGACTTCTCCCAGGCCCTGAAGAAGAAGGTGCTGCAGAACGCCCGGGGGAGCCTGACCCTGGA
CGTCCAGCCCAGCATCTTCCACTACACCATAGAAGCCAGCAACTTGGCTCTTTTTGGAGAGCGGCTGGGC
CTGGTTGGCCACAGCCCCAGTTCTGCCAGCCTGAACTTCCTCCATGCCCTGGAGGTCATGTTCAAATCCA
CCGTCCAGCTCATGTTCATGCCCAGGAGCCTGTCTCGCTGGACCAGCCCCAAGGTGTGGAAGGAGCACTT
TGAGGCCTGGGACTGCATCTTCCAGTACGGCGACAACTGTATCCAGAAAATCTATCAGGAACTGGCCTTC
AGCCGCCCTCAACAGTACACCAGCATCGTGGCAGAGCTCCTGTTGAATGCGGAACTGTCGCCAGATGCCA
TCAAGGCCAACTCTATGGAACTCACTGCAGGGAGCGTGGACACGACGGTGTTTCCCTTGCTGATGACGCT
CTTTGAGCTGGCTCGGAACCCCAACGTGCAGCAGGCCCTGCGCCAGGAGAGCCTGGCCGCCGCAGCCAGC
ATCAGTGAACATCCCCAGAAGGCAACCACCGAGCTGCCCTTGCTGCGTGCGGCCCTCAAGGAGACCTTGC
GGCTCTACCCTGTGGGTCTGTTTCTGGAGCGAGTGGCGAGCTCAGACTTGGTGCTTCAGAACTACCACAT
CCCAGCTGGGACATTGGTGCGCGTGTTCCTCTACTCTCTGGGTCGCAACCCCGCCTTGTTCCCGAGGCCT
GAGCGCTATAACCCCCAGCGCTGGCTAGACATCAGGGGCTCCGGCAGGAACTTCTACCACGTGCCCTTTG
GCTTTGGCATGCGCCAGTGCCTTGGGCGGCGCCTGGCAGAGGCAGAGATGCTGCTGCTGCTGCACCATGT
GCTGAAACACCTCCAGGTGGAGACACTAACCCAAGAGGACATAAAGATGGTCTACAGCTTCATATTGAGG
CCCAGCATGTTCCCCCTCCTCACCTTCAGAGCCATCAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC216551 representing NM_000497
Red=Cloning site Green=Tags(s)

MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQ
TFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFN
RLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLG
LVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAF
SRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAAS
ISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRP
ERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILR
PSMFPLLTFRAIN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000497
ORF Size 1509 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000497.1, NM_000497.2, NM_000497.3, NP_000488
RefSeq Size 3551
RefSeq ORF 1512
Locus ID 1584
Cytogenetics 8q24.3
Protein Families P450, Druggable Genome
Protein Pathways C21-Steroid hormone metabolism, Androgen and estrogen metabolism, Metabolic pathways
MW 57.57 kDa
Gene Summary Has steroid 11-beta-hydroxylase activity. In addition to this activity, the 18 or 19-hydroxylation of steroids and the aromatization of androstendione to estrone have also been ascribed to cytochrome P450 XIB. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations