OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LAT2 (SLC7A8) (NM_182728) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC216468
SLC7A8 (Myc-DDK-tagged)-Human solute carrier family 7 (amino acid transporter, L-type), member 8 (SLC7A8), transcript variant 2
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $499.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA500515 Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI7D6 (formerly 7D6) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "LAT2 or NM_182728"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LAT2
Synonyms LAT2; LPI-PC1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC216468 representing NM_182728.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGGGGATTGTACAGATATGCAAAGGAGAGTACTTCTGGCTGGAGCCAAAGAATGCATTTGAGAATTTC
CAGGAACCTGACATCGGCCTCGTCGCACTGGCTTTCCTTCAGGGCTCCTTTGCCTATGGAGGCTGGAAC
TTTCTGAATTACGTGACTGAGGAGCTTGTTGATCCCTACAAGAACCTTCCCAGAGCCATCTTCATCTCC
ATCCCACTGGTCACATTTGTGTATGTCTTTGCCAATGTCGCTTATGTCACTGCAATGTCCCCCCAGGAG
CTGCTGGCATCCAACGCCGTCGCTGTGACTTTTGGAGAGAAGCTCCTAGGAGTCATGGCCTGGATCATG
CCCATTTCTGTTGCCCTGTCCACATTTGGAGGAGTTAATGGGTCTCTCTTCACCTCCTCTCGGCTGTTC
TTCGCTGGAGCCCGAGAGGGCCACCTTCCCAGTGTGTTGGCCATGATCCACGTGAAGCGCTGCACCCCA
ATCCCAGCCCTGCTCTTCACATGCATCTCCACCCTGCTGATGCTGGTCACCAGTGACATGTACACACTC
ATCAACTACGTGGGCTTCATCAACTACCTCTTCTATGGGGTCACGGTTGCTGGACAGATAGTCCTTCGC
TGGAAGAAGCCTGATATCCCCCGCCCCATCAAGATCAACCTGCTGTTCCCCATCATCTACTTGCTGTTC
TGGGCCTTCCTGCTGGTCTTCAGCCTGTGGTCAGAGCCGGTGGTGTGTGGCATTGGCCTGGCCATCATG
CTGACAGGAGTGCCTGTCTATTTCCTGGGTGTTTACTGGCAACACAAGCCCAAGTGTTTCAGTGACTTC
ATTGAGCTGCTAACCCTGGTGAGCCAGAAGATGTGTGTGGTCGTGTACCCCGAGGTGGAGCGGGGCTCA
GGGACAGAGGAGGCTAATGAGGACATGGAGGAGCAGCAGCAGCCCATGTACCAACCCACTCCCACGAAG
GACAAGGACGTGGCGGGGCAGCCCCAGCCC
ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAGGTTTAAACGGCCGGC
Protein Sequence
>Peptide sequence encoded by RC216468
Blue=ORF Red=Cloning site Green=Tag(s)

MGIVQICKGEYFWLEPKNAFENFQEPDIGLVALAFLQGSFAYGGWNFLNYVTEELVDPYKNLPRAIFIS
IPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLF
FAGAREGHLPSVLAMIHVKRCTPIPALLFTCISTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLR
WKKPDIPRPIKINLLFPIIYLLFWAFLLVFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFSDF
IELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP
myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_182728
ORF Size 996 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq Size 3195 bp
RefSeq ORF 999 bp
Locus ID 23428
UniProt ID Q9UHI5
Cytogenetics 14q11.2
Protein Families Druggable Genome, Transmembrane
MW 37.2 kDa
Summary Sodium-independent, high-affinity transport of small and large neutral amino acids such as alanine, serine, threonine, cysteine, phenylalanine, tyrosine, leucine, arginine and tryptophan, when associated with SLC3A2/4F2hc. Acts as an amino acid exchanger. Has higher affinity for L-phenylalanine than LAT1 but lower affinity for glutamine and serine. L-alanine is transported at physiological concentrations. Plays a role in basolateral (re)absorption of neutral amino acids. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. Involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. Plays an essential role in the reabsorption of neutral amino acids from the epithelial cells to the bloodstream in the kidney.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_182728" in other vectors (4)
SKU Description Size Price
RC216468L3 Lenti ORF clone of Human solute carrier family 7 (amino acid transporter, L-type), member 8 (SLC7A8), transcript variant 2, Myc-DDK-tagged 10 ug
$799.00
RC216468L4 Lenti ORF clone of Human solute carrier family 7 (amino acid transporter, L-type), member 8 (SLC7A8), transcript variant 2, mGFP tagged 10 ug
$799.00
RG216468 SLC7A8 (tGFP-tagged) - Human solute carrier family 7 (amino acid transporter, L-type), member 8 (SLC7A8), transcript variant 2 10 ug
$489.00 $699.00
SC107507 SLC7A8 (untagged)-Human solute carrier family 7 (amino acid transporter, L-type), member 8 (SLC7A8), transcript variant 2 10 ug
$300.00

Plasmid Map for RC216468

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC216468
Circular map for RC216468

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products