CDC2L1(CDK11B) (NM_033486) Human Tagged ORF Clone

CAT#: RC216465

CDK11B (Myc-DDK-tagged)-Human cyclin-dependent kinase 11B (CDK11B), transcript variant 2

Change vector?

  • TrueORF®

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CDC2L1(CDK11B) (NM_033486) Human Tagged ORF Clone
Symbol CDK11B
Synonyms CDC2L1; CDK11; CDK11-p110; CDK11-p46; CDK11-p58; CLK-1; p58; p58CDC2L1; p58CLK-1; PITSLREA;
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC216465 representing NM_033486
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTGATGAAAAGGACTCTTGGAAAGTGAAAACTTTAGATGAAATTCTTCAGGAAAAGAAACGAAGGA
AGGAACAAGAGGAGAAAGCAGAGATAAAACGCTTAAAAAATTCTGATGACCGGGATTCCAAGCGGGATTC
CCTTGAGGAGGGGGAGCTGAGAGATCACCGCATGGAGATCACAATAAGGAACTCCCCGTATAGAAGAGAA
GACTCTATGGAAGACAGAGGAGAAGAAGATGATTCTTTGGCCATCAAACCACCCCAGCAAATGTCTCGGA
AAGAAAAAGTTCATCACAGAAAAGATGAAAAGAGAAAAGAGAAACGTAGGCATCGTAGCCATTCAGCAGA
AGGGGGGAAGCATGCTAGAGTGAAAGAAAAAGAAAGAGAGCACGAACGTCGGAAACGACATCGAGAAGAA
CAGGATAAAGCTCGCCGGGAATGGGAAAGACAGAAGAGAAGGGAAATGGCAAGGGAGCATTCCAGGAGAG
AAAGGGACCGCTTGGAGCAGTTAGAAAGGAAGCGGGAGCGGGAGCGCAAGATGCGGGAGCAGCAGAAGGA
GCAGCGGGAGCAGAAGGAGCGCGAGCGGCGGGCGGAGGAGCGGCGCAAGGAGCGGGAGGCCCGCAGGGAA
GTGTCTGCACATCACCGAACGATGAGAGAGGACTACAGCGACAAAGTGAAAGCCAGCCACTGGAGTCGCA
GCCCGCCTCGGCCGCCGCGGGAGCGGTTCGAGTTGGGAGACGGCCGGAAGCCAGTAAAAGAAGAGAAAAT
GGAAGAAAGGGACCTGCTGTCCGACTTACAGGACATCAGCGACAGCGAGAGGAAGACCAGCTCGGCCGAG
TCCTCGTCAGCAGAATCAGGCTCAGGTTCTGAGGAAGAAGAGGAGGAGGAGGAAGAGGAGGAGGAGGAAG
GGAGCACCAGTGAAGAATCAGAGGAGGAGGAGGAGGAAGAGGAAGAGGAGGAGGAGGAGACCGGCAGCAA
CTCTGAGGAGGCATCAGAGCAGTCTGCCGAAGAAGTAAGTGAGGAAGAAATGAGTGAAGATGAAGAACGA
GAAAATGAAAACCACCTCTTGGTTGTTCCAGAGTCACGGTTCGACCGAGATTCCGGGGAGAGTGAAGAAG
CAGAGGAAGAAGTGGGTGAGGGAACGCCGCAGAGCAGCGCCCTGACAGAGGGCGACTATGTGCCCGACTC
CCCTGCCCTGTCGCCCATCGAGCTCAAGCAGGAGCTGCCCAAGTACCTGCCGGCCCTGCAGGGCTGCCGG
AGCGTCGAGGAGTTCCAGTGCCTGAACAGGATCGAGGAGGGCACCTATGGAGTGGTCTACAGAGCAAAAG
ACAAGAAAACAGATGAAATTGTGGCTCTAAAGCGGCTGAAGATGGAGAAGGAGAAGGAGGGCTTCCCGAT
CACGTCGCTGAGGGAGATCAACACCATCCTCAAGGCCCAGCATCCCAACATCGTCACCGTTAGAGAGATT
GTGGTGGGCAGCAACATGGACAAGATCTACATCGTGATGAACTATGTGGAGCACGACCTCAAGAGCCTGA
TGGAGACCATGAAACAGCCCTTCCTGCCAGGGGAGGTGAAGACCCTGATGATCCAGCTGCTGCGTGGGGT
GAAACACCTGCACGACAACTGGATCCTGCACCGTGACCTCAAGACGTCCAACCTGCTGCTGAGCCACGCC
GGCATCCTCAAGGTGGGTGACTTCGGGCTGGCGCGGGAGTACGGATCCCCTCTGAAGGCCTACACCCCGG
TCGTGGTGACCCTGTGGTACCGCGCCCCAGAGCTGCTGCTTGGTGCCAAGGAATACTCCACGGCCGTGGA
CATGTGGTCAGTGGGTTGCATCTTCGGGGAGCTGCTGACTCAGAAGCCTCTGTTCCCCGGGAAGTCAGAA
ATCGATCAGATCAACAAGGTGTTCAAGGATCTGGGGACCCCTAGTGAGAAAATCTGGCCCGGCTACAGCG
AGCTCCCAGCAGTCAAGAAGATGACCTTCAGCGAGCACCCCTACAACAACCTCCGCAAGCGCTTCGGGGC
TCTGCTCTCAGACCAGGGCTTCGACCTCATGAACAAGTTCCTGACCTACTTCCCCGGGAGGAGGATCAGC
GCTGAGGACGGCCTCAAGCATGAGTATTTCCGCGAGACCCCCCTCCCCATCGACCCCTCCATGTTCCCCA
CGTGGCCCGCCAAGAGCGAGCAGCAGCGTGTGAAGCGGGGCACCAGCCCGAGGCCCCCTGAGGGAGGCCT
GGGCTACAGCCAGCTGGGTGACGACGACCTGAAGGAGACGGGCTTCCACCTTACCACCACGAACCAGGGG
GCCTCTGCCGCGGGCCCCGGCTTCAGCCTCAAGTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC216465 representing NM_033486
Red=Cloning site Green=Tags(s)

MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRRE
DSMEDRGEEDDSLAIKPPQQMSRKEKVHHRKDEKRKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREE
QDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARRE
VSAHHRTMREDYSDKVKASHWSRSPPRPPRERFELGDGRKPVKEEKMEERDLLSDLQDISDSERKTSSAE
SSSAESGSGSEEEEEEEEEEEEEGSTSEESEEEEEEEEEEEEETGSNSEEASEQSAEEVSEEEMSEDEER
ENENHLLVVPESRFDRDSGESEEAEEEVGEGTPQSSALTEGDYVPDSPALSPIELKQELPKYLPALQGCR
SVEEFQCLNRIEEGTYGVVYRAKDKKTDEIVALKRLKMEKEKEGFPITSLREINTILKAQHPNIVTVREI
VVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLPGEVKTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHA
GILKVGDFGLAREYGSPLKAYTPVVVTLWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKSE
IDQINKVFKDLGTPSEKIWPGYSELPAVKKMTFSEHPYNNLRKRFGALLSDQGFDLMNKFLTYFPGRRIS
AEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQG
ASAAGPGFSLKF

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_033486
ORF Size 2346 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_033486.1, NM_033486.2, NP_277021
RefSeq Size 2486
RefSeq ORF 2349
Locus ID 984
Cytogenetics 1p36.33
Protein Families Transcription Factors, Druggable Genome
MW 91.2 kDa
Gene Summary This gene encodes a member of the serine/threonine protein kinase family. Members of this kinase family are known to be essential for eukaryotic cell cycle control. Due to a segmental duplication, this gene shares very high sequence identity with a neighboring gene. These two genes are frequently deleted or altered in neuroblastoma. The protein kinase encoded by this gene can be cleaved by caspases and may play a role in cell apoptosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations