Phospholipase C gamma 1 (PLCG1) (NM_002660) Human Tagged ORF Clone

CAT#: RC216448

Reviews ()
Write a review

PLCG1 (Myc-DDK-tagged)-Human phospholipase C, gamma 1 (PLCG1), transcript variant 1



  "NM_002660" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,144.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PLCG1
Synonyms NCKAP3; PLC-II; PLC1; PLC148; PLCgamma1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC216448 representing NM_002660
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGCGCCGCGTCCCCTTGCGCCAACGGCTGCGGGCCCGGCGCGCCCTCGGACGCCGAGGTGCTGC
ACCTCTGCCGCAGCCTCGAGGTGGGCACCGTCATGACTTTGTTCTACTCCAAGAAGTCGCAGCGACCCGA
GCGGAAGACCTTCCAGGTCAAGCTGGAGACGCGCCAGATCACGTGGAGCCGGGGCGCCGACAAGATCGAG
GGGGCCATTGACATTCGTGAAATTAAGGAGATCCGCCCAGGGAAGACCTCACGGGACTTTGATCGCTATC
AAGAGGACCCAGCTTTCCGGCCGGACCAGTCACATTGCTTTGTCATTCTCTATGGAATGGAATTTCGCCT
GAAAACGCTGAGCCTGCAAGCCACATCTGAGGATGAAGTGAACATGTGGATCAAGGGCTTAACTTGGCTG
ATGGAGGATACATTGCAGGCACCCACACCCCTGCAGATTGAGAGGTGGCTCCGGAAGCAGTTTTACTCAG
TGGATCGGAATCGTGAGGATCGTATATCAGCCAAGGACCTGAAGAACATGCTGTCCCAGGTCAACTACCG
GGTCCCCAACATGCGCTTCCTCCGAGAGCGGCTGACGGACCTGGAGCAGCGCAGCGGGGACATCACCTAC
GGGCAGTTTGCTCAGCTGTACCGCAGCCTCATGTACAGCGCCCAGAAGACGATGGACCTCCCCTTCTTGG
AAGCCAGTACTCTGAGGGCTGGGGAGCGGCCGGAGCTTTGCCGAGTGTCCCTTCCTGAGTTCCAGCAGTT
CCTTCTTGACTACCAGGGGGAGCTGTGGGCTGTTGATCGCCTCCAGGTGCAGGAGTTCATGCTCAGCTTC
CTCCGAGACCCCTTACGAGAGATCGAGGAGCCATACTTCTTCCTGGATGAGTTTGTCACCTTCCTGTTCT
CCAAAGAGAACAGTGTGTGGAACTCGCAGCTGGATGCAGTATGCCCGGACACCATGAACAACCCTCTTTC
CCACTACTGGATCTCCTCCTCGCACAACACGTACCTGACCGGGGACCAGTTCTCCAGTGAGTCCTCCTTG
GAAGCCTATGCTCGCTGCCTGCGGATGGGCTGTCGCTGCATTGAGTTGGACTGCTGGGACGGCCCGGATG
GGATGCCAGTTATTTACCATGGGCACACCCTTACCACCAAGATCAAGTTCTCAGATGTCCTGCACACCAT
CAAGGAGCATGCCTTTGTGGCCTCAGAGTACCCAGTCATCCTGTCCATTGAGGACCACTGCAGCATTGCC
CAGCAGAGAAACATGGCCCAATACTTCAAGAAGGTGCTGGGGGACACACTCCTCACCAAGCCCGTGGAGA
TCTCTGCCGACGGGCTCCCCTCACCCAACCAGCTTAAGAGGAAGATCCTCATCAAGCACAAGAAGCTGGC
TGAGGGCAGTGCCTACGAGGAGGTGCCTACATCCATGATGTACTCTGAGAACGACATCAGCAACTCTATC
AAGAATGGCATCCTCTACCTGGAGGACCCTGTGAACCACGAATGGTATCCCCACTACTTTGTTCTGACCA
GCAGCAAGATCTACTACTCTGAGGAGACCAGCAGTGACCAGGGCAACGAGGATGAGGAGGAGCCCAAGGA
GGTCAGCAGCAGCACAGAGCTGCACTCCAATGAGAAGTGGTTCCATGGGAAGCTAGGGGCAGGGCGTGAC
GGGCGTCACATCGCTGAGCGCCTGCTTACTGAGTACTGCATCGAGACCGGAGCCCCTGACGGCTCCTTCC
TCGTGCGAGAGAGTGAGACCTTCGTGGGCGACTACACGCTCTCTTTCTGGCGGAACGGGAAAGTCCAGCA
CTGCCGTGTCCACTCCCGGCAAGATGCTGGGACCCCCAAGTTCTTCTTGACAGACAACCTCGTCTTTGAC
TCCCTCTATGACCTCATCACGCACTACCAGCAGGTGCCCCTGCGCTGTAATGAGTTTGAGATGCGACTTT
CAGAGCCTGTCCCACAGACCAACGCCCACGAGAGCAAAGAGTGGTACCACGCGAGCCTGACCAGAGCACA
GGCTGAGCACATGCTAATGCGCGTCCCTCGTGATGGGGCCTTCCTGGTGCGGAAGCGGAATGAACCCAAC
TCATATGCCATCTCTTTCCGGGCTGAGGGCAAGATCAAGCATTGCCGTGTCCAGCAAGAGGGCCAGACAG
TGATGCTAGGGAACTCGGAGTTCGACAGCCTTGTTGACCTCATCAGCTACTATGAGAAACACCCGCTATA
CCGCAAGATGAAGCTGCGCTATCCCATCAACGAGGAGGCACTGGAGAAGATTGGCACAGCTGAGCCTGAC
TACGGGGCCCTGTATGAGGGACGCAACCCTGGCTTCTATGTAGAGGCAAACCCTATGCCAACTTTCAAGT
GTGCAGTCAAAGCCCTCTTTGACTACAAGGCCCAGAGGGAGGACGAGCTGACCTTCACCAAGAGCGCCAT
CATCCAGAATGTGGAGAAGCAAGAGGGAGGCTGGTGGCGAGGGGACTACGGAGGGAAGAAGCAGCTGTGG
TTCCCATCAAACTACGTGGAAGAGATGGTCAACCCCGTGGCCCTGGAGCCGGAGAGGGAGCACTTGGACG
AGAACAGCCCCCTAGGGGACTTGCTGCGGGGGGTCTTGGATGTGCCGGCTTGTCAGATTGCCATCCGTCC
TGAGGGCAAGAACAACCGGCTCTTCGTCTTCTCCATCAGCATGGCGTCGGTGGCCCACTGGTCCCTGGAT
GTTGCTGCCGACTCACAGGAGGAGCTGCAGGACTGGGTGAAAAAGATCCGTGAAGTGGCCCAGACAGCAG
ACGCCAGGCTCACTGAAGGGAAGATAATGGAACGGAGGAAGAAGATTGCCCTGGAGCTCTCTGAACTTGT
CGTCTACTGCCGGCCTGTTCCCTTTGATGAAGAGAAGATTGGCACAGAACGTGCTTGCTACCGGGACATG
TCATCCTTCCCGGAAACCAAGGCTGAGAAATACGTGAACAAGGCCAAAGGCAAGAAGTTCCTTCAGTACA
ATCGACTGCAGCTCTCCCGCATCTACCCCAAGGGCCAGCGACTGGATTCCTCCAACTACGATCCTTTGCC
CATGTGGATCTGTGGCAGTCAGCTTGTGGCCCTCAACTTCCAGACCCCTGACAAGCCTATGCAGATGAAC
CAGGCCCTCTTCATGACGGGCAGGCACTGTGGCTACGTGCTGCAGCCAAGCACCATGCGGGATGAGGCCT
TCGACCCCTTTGACAAGAGCAGCCTCCGCGGGCTGGAGCCATGTGCCATCTCTATTGAGGTGCTGGGGGC
CCGACATCTGCCAAAGAATGGCCGAGGCATTGTGTGTCCTTTTGTGGAGATTGAGGTGGCTGGAGCTGAG
TATGACAGCACCAAGCAGAAGACAGAGTTTGTGGTGGACAATGGACTCAACCCTGTATGGCCAGCCAAGC
CCTTCCACTTCCAGATCAGTAACCCTGAATTTGCCTTTCTGCGCTTCGTGGTGTATGAGGAAGACATGTT
TAGTGACCAGAATTTCCTGGCTCAGGCTACTTTCCCAGTAAAAGGCCTGAAGACAGGATACAGAGCAGTG
CCTTTGAAGAACAACTACAGTGAGGACCTGGAGTTGGCCTCCCTGCTGATCAAGATTGACATTTTCCCTG
CCAAGCAGGAGAATGGTGACCTCAGTCCCTTCAGTGGTACGTCCCTGCGGGAGCGGGGCTCAGATGCCTC
AGGCCAGCTGTTTCATGGCCGAGCCCGGGAAGGCTCCTTTGAATCCCGCTACCAGCAGCCGTTTGAGGAC
TTCCGCATCTCCCAGGAGCATCTCGCAGACCATTTTGACAGTCGAGAACGAAGGGCCCCAAGAAGGACTC
GGGTCAATGGAGACAACCGCCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC216448 representing NM_002660
Red=Cloning site Green=Tags(s)

MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQITWSRGADKIE
GAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTLSLQATSEDEVNMWIKGLTWL
MEDTLQAPTPLQIERWLRKQFYSVDRNREDRISAKDLKNMLSQVNYRVPNMRFLRERLTDLEQRSGDITY
GQFAQLYRSLMYSAQKTMDLPFLEASTLRAGERPELCRVSLPEFQQFLLDYQGELWAVDRLQVQEFMLSF
LRDPLREIEEPYFFLDEFVTFLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSL
EAYARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVEISADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSMMYSENDISNSI
KNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSSSTELHSNEKWFHGKLGAGRD
GRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRVHSRQDAGTPKFFLTDNLVFD
SLYDLITHYQQVPLRCNEFEMRLSEPVPQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPN
SYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPD
YGALYEGRNPGFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVNPVALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSISMASVAHWSLD
VAADSQEELQDWVKKIREVAQTADARLTEGKIMERRKKIALELSELVVYCRPVPFDEEKIGTERACYRDM
SSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQMN
QALFMTGRHCGYVLQPSTMRDEAFDPFDKSSLRGLEPCAISIEVLGARHLPKNGRGIVCPFVEIEVAGAE
YDSTKQKTEFVVDNGLNPVWPAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAV
PLKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFED
FRISQEHLADHFDSRERRAPRRTRVNGDNRL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002660
ORF Size 3873 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002660.3
RefSeq Size 5205 bp
RefSeq ORF 3876 bp
Locus ID 5335
UniProt ID P19174
Cytogenetics 20q12
Domains C2, PI-PLC-X, SH2, SH3, PI-PLC-Y, PH
Protein Families Druggable Genome
Protein Pathways Calcium signaling pathway, Epithelial cell signaling in Helicobacter pylori infection, ErbB signaling pathway, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Glioma, Inositol phosphate metabolism, Leukocyte transendothelial migration, Metabolic pathways, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway, Non-small cell lung cancer, Pathways in cancer, Phosphatidylinositol signaling system, T cell receptor signaling pathway, VEGF signaling pathway, Vibrio cholerae infection
MW 148.5 kDa
Gene Summary The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of receptor-mediated tyrosine kinase activators. For example, when activated by SRC, the encoded protein causes the Ras guanine nucleotide exchange factor RasGRP1 to translocate to the Golgi, where it activates Ras. Also, this protein has been shown to be a major substrate for heparin-binding growth factor 1 (acidic fibroblast growth factor)-activated tyrosine kinase. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "PLCG1"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit polyclonal PLCG1 (Ab-771) antibody
    • 100 ul

USD 380.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.