Phospholipase C gamma 1(PLCG1) (NM_002660) Human Tagged ORF Clone

CAT#: RC216448

PLCG1 (Myc-DDK-tagged)-Human phospholipase C, gamma 1 (PLCG1), transcript variant 1

 Cited in 3 publications.

  View "NM_002660" in other vectors (10)

USD 710.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Phospholipase C gamma 1(PLCG1) (NM_002660) Human Tagged ORF Clone
Symbol PLCG1
Synonyms NCKAP3; PLC-II; PLC1; PLC148; PLCgamma1
Vector pCMV6-Entry
Sequence Data
>RC216448 representing NM_002660
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGCGCCGCGTCCCCTTGCGCCAACGGCTGCGGGCCCGGCGCGCCCTCGGACGCCGAGGTGCTGC
ACCTCTGCCGCAGCCTCGAGGTGGGCACCGTCATGACTTTGTTCTACTCCAAGAAGTCGCAGCGACCCGA
GCGGAAGACCTTCCAGGTCAAGCTGGAGACGCGCCAGATCACGTGGAGCCGGGGCGCCGACAAGATCGAG
GGGGCCATTGACATTCGTGAAATTAAGGAGATCCGCCCAGGGAAGACCTCACGGGACTTTGATCGCTATC
AAGAGGACCCAGCTTTCCGGCCGGACCAGTCACATTGCTTTGTCATTCTCTATGGAATGGAATTTCGCCT
GAAAACGCTGAGCCTGCAAGCCACATCTGAGGATGAAGTGAACATGTGGATCAAGGGCTTAACTTGGCTG
ATGGAGGATACATTGCAGGCACCCACACCCCTGCAGATTGAGAGGTGGCTCCGGAAGCAGTTTTACTCAG
TGGATCGGAATCGTGAGGATCGTATATCAGCCAAGGACCTGAAGAACATGCTGTCCCAGGTCAACTACCG
GGTCCCCAACATGCGCTTCCTCCGAGAGCGGCTGACGGACCTGGAGCAGCGCAGCGGGGACATCACCTAC
GGGCAGTTTGCTCAGCTGTACCGCAGCCTCATGTACAGCGCCCAGAAGACGATGGACCTCCCCTTCTTGG
AAGCCAGTACTCTGAGGGCTGGGGAGCGGCCGGAGCTTTGCCGAGTGTCCCTTCCTGAGTTCCAGCAGTT
CCTTCTTGACTACCAGGGGGAGCTGTGGGCTGTTGATCGCCTCCAGGTGCAGGAGTTCATGCTCAGCTTC
CTCCGAGACCCCTTACGAGAGATCGAGGAGCCATACTTCTTCCTGGATGAGTTTGTCACCTTCCTGTTCT
CCAAAGAGAACAGTGTGTGGAACTCGCAGCTGGATGCAGTATGCCCGGACACCATGAACAACCCTCTTTC
CCACTACTGGATCTCCTCCTCGCACAACACGTACCTGACCGGGGACCAGTTCTCCAGTGAGTCCTCCTTG
GAAGCCTATGCTCGCTGCCTGCGGATGGGCTGTCGCTGCATTGAGTTGGACTGCTGGGACGGCCCGGATG
GGATGCCAGTTATTTACCATGGGCACACCCTTACCACCAAGATCAAGTTCTCAGATGTCCTGCACACCAT
CAAGGAGCATGCCTTTGTGGCCTCAGAGTACCCAGTCATCCTGTCCATTGAGGACCACTGCAGCATTGCC
CAGCAGAGAAACATGGCCCAATACTTCAAGAAGGTGCTGGGGGACACACTCCTCACCAAGCCCGTGGAGA
TCTCTGCCGACGGGCTCCCCTCACCCAACCAGCTTAAGAGGAAGATCCTCATCAAGCACAAGAAGCTGGC
TGAGGGCAGTGCCTACGAGGAGGTGCCTACATCCATGATGTACTCTGAGAACGACATCAGCAACTCTATC
AAGAATGGCATCCTCTACCTGGAGGACCCTGTGAACCACGAATGGTATCCCCACTACTTTGTTCTGACCA
GCAGCAAGATCTACTACTCTGAGGAGACCAGCAGTGACCAGGGCAACGAGGATGAGGAGGAGCCCAAGGA
GGTCAGCAGCAGCACAGAGCTGCACTCCAATGAGAAGTGGTTCCATGGGAAGCTAGGGGCAGGGCGTGAC
GGGCGTCACATCGCTGAGCGCCTGCTTACTGAGTACTGCATCGAGACCGGAGCCCCTGACGGCTCCTTCC
TCGTGCGAGAGAGTGAGACCTTCGTGGGCGACTACACGCTCTCTTTCTGGCGGAACGGGAAAGTCCAGCA
CTGCCGTGTCCACTCCCGGCAAGATGCTGGGACCCCCAAGTTCTTCTTGACAGACAACCTCGTCTTTGAC
TCCCTCTATGACCTCATCACGCACTACCAGCAGGTGCCCCTGCGCTGTAATGAGTTTGAGATGCGACTTT
CAGAGCCTGTCCCACAGACCAACGCCCACGAGAGCAAAGAGTGGTACCACGCGAGCCTGACCAGAGCACA
GGCTGAGCACATGCTAATGCGCGTCCCTCGTGATGGGGCCTTCCTGGTGCGGAAGCGGAATGAACCCAAC
TCATATGCCATCTCTTTCCGGGCTGAGGGCAAGATCAAGCATTGCCGTGTCCAGCAAGAGGGCCAGACAG
TGATGCTAGGGAACTCGGAGTTCGACAGCCTTGTTGACCTCATCAGCTACTATGAGAAACACCCGCTATA
CCGCAAGATGAAGCTGCGCTATCCCATCAACGAGGAGGCACTGGAGAAGATTGGCACAGCTGAGCCTGAC
TACGGGGCCCTGTATGAGGGACGCAACCCTGGCTTCTATGTAGAGGCAAACCCTATGCCAACTTTCAAGT
GTGCAGTCAAAGCCCTCTTTGACTACAAGGCCCAGAGGGAGGACGAGCTGACCTTCACCAAGAGCGCCAT
CATCCAGAATGTGGAGAAGCAAGAGGGAGGCTGGTGGCGAGGGGACTACGGAGGGAAGAAGCAGCTGTGG
TTCCCATCAAACTACGTGGAAGAGATGGTCAACCCCGTGGCCCTGGAGCCGGAGAGGGAGCACTTGGACG
AGAACAGCCCCCTAGGGGACTTGCTGCGGGGGGTCTTGGATGTGCCGGCTTGTCAGATTGCCATCCGTCC
TGAGGGCAAGAACAACCGGCTCTTCGTCTTCTCCATCAGCATGGCGTCGGTGGCCCACTGGTCCCTGGAT
GTTGCTGCCGACTCACAGGAGGAGCTGCAGGACTGGGTGAAAAAGATCCGTGAAGTGGCCCAGACAGCAG
ACGCCAGGCTCACTGAAGGGAAGATAATGGAACGGAGGAAGAAGATTGCCCTGGAGCTCTCTGAACTTGT
CGTCTACTGCCGGCCTGTTCCCTTTGATGAAGAGAAGATTGGCACAGAACGTGCTTGCTACCGGGACATG
TCATCCTTCCCGGAAACCAAGGCTGAGAAATACGTGAACAAGGCCAAAGGCAAGAAGTTCCTTCAGTACA
ATCGACTGCAGCTCTCCCGCATCTACCCCAAGGGCCAGCGACTGGATTCCTCCAACTACGATCCTTTGCC
CATGTGGATCTGTGGCAGTCAGCTTGTGGCCCTCAACTTCCAGACCCCTGACAAGCCTATGCAGATGAAC
CAGGCCCTCTTCATGACGGGCAGGCACTGTGGCTACGTGCTGCAGCCAAGCACCATGCGGGATGAGGCCT
TCGACCCCTTTGACAAGAGCAGCCTCCGCGGGCTGGAGCCATGTGCCATCTCTATTGAGGTGCTGGGGGC
CCGACATCTGCCAAAGAATGGCCGAGGCATTGTGTGTCCTTTTGTGGAGATTGAGGTGGCTGGAGCTGAG
TATGACAGCACCAAGCAGAAGACAGAGTTTGTGGTGGACAATGGACTCAACCCTGTATGGCCAGCCAAGC
CCTTCCACTTCCAGATCAGTAACCCTGAATTTGCCTTTCTGCGCTTCGTGGTGTATGAGGAAGACATGTT
TAGTGACCAGAATTTCCTGGCTCAGGCTACTTTCCCAGTAAAAGGCCTGAAGACAGGATACAGAGCAGTG
CCTTTGAAGAACAACTACAGTGAGGACCTGGAGTTGGCCTCCCTGCTGATCAAGATTGACATTTTCCCTG
CCAAGCAGGAGAATGGTGACCTCAGTCCCTTCAGTGGTACGTCCCTGCGGGAGCGGGGCTCAGATGCCTC
AGGCCAGCTGTTTCATGGCCGAGCCCGGGAAGGCTCCTTTGAATCCCGCTACCAGCAGCCGTTTGAGGAC
TTCCGCATCTCCCAGGAGCATCTCGCAGACCATTTTGACAGTCGAGAACGAAGGGCCCCAAGAAGGACTC
GGGTCAATGGAGACAACCGCCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC216448 representing NM_002660
Red=Cloning site Green=Tags(s)

MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQITWSRGADKIE
GAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTLSLQATSEDEVNMWIKGLTWL
MEDTLQAPTPLQIERWLRKQFYSVDRNREDRISAKDLKNMLSQVNYRVPNMRFLRERLTDLEQRSGDITY
GQFAQLYRSLMYSAQKTMDLPFLEASTLRAGERPELCRVSLPEFQQFLLDYQGELWAVDRLQVQEFMLSF
LRDPLREIEEPYFFLDEFVTFLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSL
EAYARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVEISADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSMMYSENDISNSI
KNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSSSTELHSNEKWFHGKLGAGRD
GRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRVHSRQDAGTPKFFLTDNLVFD
SLYDLITHYQQVPLRCNEFEMRLSEPVPQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPN
SYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPD
YGALYEGRNPGFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVNPVALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSISMASVAHWSLD
VAADSQEELQDWVKKIREVAQTADARLTEGKIMERRKKIALELSELVVYCRPVPFDEEKIGTERACYRDM
SSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQMN
QALFMTGRHCGYVLQPSTMRDEAFDPFDKSSLRGLEPCAISIEVLGARHLPKNGRGIVCPFVEIEVAGAE
YDSTKQKTEFVVDNGLNPVWPAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAV
PLKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFED
FRISQEHLADHFDSRERRAPRRTRVNGDNRL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_002660
ORF Size 3873 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_002660.1, NM_002660.2, NP_002651
RefSeq Size 5205
RefSeq ORF 3876
Locus ID 5335
Cytogenetics 20q12
Domains C2, PI-PLC-X, SH2, SH3, PI-PLC-Y, PH
Protein Families Druggable Genome
Protein Pathways Inositol phosphate metabolism, Metabolic pathways, ErbB signaling pathway, Calcium signaling pathway, Phosphatidylinositol signaling system, VEGF signaling pathway, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Leukocyte transendothelial migration, Neurotrophin signaling pathway, Vibrio cholerae infection, Epithelial cell signaling in Helicobacter pylori infection, Pathways in cancer, Glioma, Non-small cell lung cancer
MW 148.5 kDa
Gene Summary The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of receptor-mediated tyrosine kinase activators. For example, when activated by SRC, the encoded protein causes the Ras guanine nucleotide exchange factor RasGRP1 to translocate to the Golgi, where it activates Ras. Also, this protein has been shown to be a major substrate for heparin-binding growth factor 1 (acidic fibroblast growth factor)-activated tyrosine kinase. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].

Citations (3)

Other Versions

Other products for "PLCG1"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00


Rabbit polyclonal PLCG1 (Ab-771) antibody
    • 100 ul

USD 335.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones