SLC6A11 (NM_014229) Human Tagged ORF Clone

CAT#: RC216392

Reviews ()
Write a review

SLC6A11 (Myc-DDK-tagged)-Human solute carrier family 6 (neurotransmitter transporter, GABA), member 11 (SLC6A11)



  "NM_014229" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 118.00

USD 858.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SLC6A11
Synonyms GAT-3; GAT3; GAT4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC216392 representing NM_014229
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGGCGGAGAAGGCGCTGCCCCTGGGCAATGGGAAGGCTGCTGAGGAGGCGCGGGAGTCCGAGGCGC
CGGGTGGCGGCTGCAGCAGCGGGGGCGCGGCGCCCGCGCGCCACCCGCGCGTCAAGCGCGACAAGGCGGT
CCACGAGCGCGGCCACTGGAACAACAAGGTGGAGTTCGTGCTGAGCGTGGCCGGGGAGATCATTGGGCTG
GGCAACGTGTGGCGCTTCCCCTACCTGTGCTACAAGAACGGAGGAGGGGCATTCCTGATTCCCTACGTGG
TGTTTTTTATTTGCTGTGGAATTCCTGTTTTTTTCCTGGAGACAGCTCTGGGGCAGTTCACAAGTGAAGG
TGGCATTACGTGTTGGAGGAAAGTTTGCCCTTTATTTGAAGGCATTGGCTATGCAACACAGGTGATTGAG
GCCCATCTGAATGTGTACTACATCATCATCCTGGCATGGGCCATTTTTTACCTGAGCAACTGCTTCACTA
CTGAGCTACCCTGGGCTACCTGTGGGCATGAGTGGAACACAGAGAATTGTGTGGAGTTCCAGAAACTGAA
TGTGAGCAACTACAGCCATGTGTCTCTGCAGAATGCCACCTCCCCTGTCATGGAGTTTTGGGAGCACCGG
GTCCTGGCCATCTCTGACGGGATCGAGCACATCGGGAACCTTCGCTGGGAGCTGGCCTTGTGTCTCTTGG
CAGCCTGGACCATCTGTTACTTCTGTATCTGGAAGGGGACCAAGTCTACAGGAAAGGTTGTATACGTGAC
TGCGACATTCCCCTACATCATGCTGCTGATCCTCCTGATACGAGGGGTCACGTTGCCCGGGGCCTCAGAG
GGCATCAAGTTCTACTTGTACCCTGACCTCTCCCGGCTCTCCGACCCCCAGGTCTGGGTAGATGCTGGAA
CGCAGATCTTTTTCTCCTATGCCATTTGCCTGGGCTGTCTGACCGCTCTGGGAAGTTATAACAATTATAA
CAACAACTGCTACAGGGACTGCATCATGCTCTGTTGCCTGAACAGCGGCACCAGCTTCGTGGCTGGGTTT
GCCATCTTCTCAGTCCTGGGTTTTATGGCGTACGAGCAGGGGGTACCCATTGCTGAGGTGGCAGAGTCAG
GCCCCGGCCTGGCCTTTATTGCGTACCCCAAGGCGGTCACCATGATGCCTCTCTCCCCGCTGTGGGCCAC
CTTGTTCTTCATGATGCTCATCTTCCTGGGCCTGGACAGCCAGTTTGTGTGTGTGGAAAGCCTGGTGACC
GCCGTGGTGGACATGTACCCCAAGGTTTTCCGGAGGGGTTACCGGCGGGAGCTGCTCATCCTAGCCTTGT
CTGTTATCTCCTATTTTCTGGGCCTCGTGATGTTAACAGAGGGTGGCATGTACATCTTCCAGCTCTTTGA
CTCCTATGCCGCCAGTGGGATGTGCCTTCTCTTCGTGGCCATCTTTGAGTGCATCTGCATCGGCTGGGTG
TATGGAAGCAACCGGTTCTATGATAACATTGAAGACATGATTGGCTACCGGCCACCGTCGCTCATTAAGT
GGTGCTGGATGATCATGACCCCTGGGATCTGCGCGGGGATCTTCATCTTCTTCTTGATCAAGTACAAGCC
ACTCAAGTACAACAACATCTACACCTACCCAGCCTGGGGCTATGGCATTGGCTGGCTCATGGCCCTGTCC
TCCATGCTCTGCATCCCGCTCTGGATCTGCATCACAGTGTGGAAGACGGAGGGGACACTGCCCGAGAAAC
TCCAGAAGTTGACGACCCCCAGCACAGATCTGAAAATGCGGGGCAAGCTTGGGGTGAGCCCACGGATGGT
GACAGTTAATGACTGTGATGCCAAACTCAAGAGTGACGGGACCATCGCAGCCATCACAGAGAAGGAGACG
CACTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC216392 representing NM_014229
Red=Cloning site Green=Tags(s)

MTAEKALPLGNGKAAEEARESEAPGGGCSSGGAAPARHPRVKRDKAVHERGHWNNKVEFVLSVAGEIIGL
GNVWRFPYLCYKNGGGAFLIPYVVFFICCGIPVFFLETALGQFTSEGGITCWRKVCPLFEGIGYATQVIE
AHLNVYYIIILAWAIFYLSNCFTTELPWATCGHEWNTENCVEFQKLNVSNYSHVSLQNATSPVMEFWEHR
VLAISDGIEHIGNLRWELALCLLAAWTICYFCIWKGTKSTGKVVYVTATFPYIMLLILLIRGVTLPGASE
GIKFYLYPDLSRLSDPQVWVDAGTQIFFSYAICLGCLTALGSYNNYNNNCYRDCIMLCCLNSGTSFVAGF
AIFSVLGFMAYEQGVPIAEVAESGPGLAFIAYPKAVTMMPLSPLWATLFFMMLIFLGLDSQFVCVESLVT
AVVDMYPKVFRRGYRRELLILALSVISYFLGLVMLTEGGMYIFQLFDSYAASGMCLLFVAIFECICIGWV
YGSNRFYDNIEDMIGYRPPSLIKWCWMIMTPGICAGIFIFFLIKYKPLKYNNIYTYPAWGYGIGWLMALS
SMLCIPLWICITVWKTEGTLPEKLQKLTTPSTDLKMRGKLGVSPRMVTVNDCDAKLKSDGTIAAITEKET
HF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014229
ORF Size 1896 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014229.3
RefSeq Size 1991 bp
RefSeq ORF 1899 bp
Locus ID 6538
UniProt ID P48066
Cytogenetics 3p25.3
Domains SNF
Protein Families Druggable Genome, Transmembrane
MW 70.4 kDa
Gene Summary The protein encoded by this gene is a sodium-dependent transporter that uptakes gamma-aminobutyric acid (GABA), an inhibitory neurotransmitter, which ends the GABA neurotransmission. Defects in this gene may result in epilepsy, behavioral problems, or intellectual problems. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015]

Other Versions

Other products for "SLC6A11"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


SLC6A11 rabbit polyclonal antibody
    • 100 ul

USD 380.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.