DIAPH1 (NM_005219) Human Tagged ORF Clone

CAT#: RC216318

DIAPH1 (Myc-DDK-tagged)-Human diaphanous homolog 1 (Drosophila) (DIAPH1), transcript variant 1

Clone Modification / Custom Cloning Service

USD 824.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DIAPH1 (NM_005219) Human Tagged ORF Clone
Symbol DIAPH1
Synonyms DFNA1; DIA1; DRF1; hDIA1; LFHL1; SCBMS
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC216318 representing NM_005219
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCCGCCCGGCGGGAGCCTGGGGCCCGGCCGCGGGACCCGGGACAAGAAGAAGGGCCGGAGCCCAG
ATGAGCTGCCCTCGGCGGGCGGCGACGGCGGCAAATCTAAGAAATTTACTCTGAAGCGGCTCATGGCAGA
TGAGCTGGAGAGATTTACCAGCATGAGAATTAAGAAGGAGAAGGAAAAGCCCAATTCTGCTCATAGAAAT
TCTTCTGCATCATATGGGGATGATCCCACAGCACAGTCATTGCAAGATGTTTCAGATGAACAAGTGCTGG
TTCTCTTTGAACAGATGCTGCTGGATATGAACCTGAATGAGGAGAAACAGCAACCTTTGAGGGAGAAGGA
CATCATCATCAAGAGGGAGATGGTGTCCCAATACTTGTACACCTCCAAGGCTGGCATGAGCCAGAAGGAG
AGCTCTAAGTCTGCCATGATGTATATTCAGGAGTTGAGGTCAGGCTTGCGGGATATGCCTCTGCTCAGCT
GCCTGGAGTCCCTTCGTGTGTCTCTCAACAACAACCCTGTCAGTTGGGTGCAAACATTTGGTGCTGAAGG
CTTGGCCTCCTTATTGGACATTCTTAAACGACTTCATGATGAGAAAGAAGAGACTGCTGGGAGTTACGAT
AGCCGGAACAAGCATGAGATCATTCGCTGCTTGAAAGCTTTTATGAACAACAAGTTTGGAATCAAGACCA
TGTTGGAGACAGAAGAAGGAATCCTACTGCTGGTCAGAGCCATGGATCCTGCTGTTCCCAACATGATGAT
TGATGCAGCTAAGCTGCTTTCTGCTCTTTGTATTCTACCGCAGCCAGAGGACATGAATGAAAGGGTTTTG
GAGGCAATGACAGAAAGAGCTGAGATGGATGAAGTGGAACGTTTCCAGCCGCTGCTGGATGGATTAAAAA
GTGGAACCACTATTGCACTGAAGGTTGGATGCCTACAGCTGATCAATGCTCTCATCACACCAGCGGAGGA
ACTTGACTTCCGAGTTCACATCAGAAGTGAACTGATGCGTTTGGGGCTACATCAGGTGTTGCAGGACCTT
CGAGAGATTGAAAATGAAGATATGAGAGTGCAACTAAATGTGTTTGATGAACAAGGGGAAGAGGATTCCT
ATGACCTGAAGGGACGGCTGGATGACATTCGCATGGAGATGGATGACTTTAATGAAGTCTTTCAGATTCT
CTTAAACACAGTGAAGGATTCAAAGGCAGAGCCACACTTCCTTTCCATCCTGCAGCACTTACTCTTGGTC
CGAAATGACTATGAGGCCAGACCTCAGTACTATAAGTTGATTGAAGAATGTATTTCCCAGATAGTTCTGC
ACAAGAACGGGGCTGATCCTGACTTCAAGTGCCGGCACCTCCAGATTGAGATTGAGGGATTAATTGATCA
AATGATTGATAAGACAAAGGTGGAGAAATCTGAAGCCAAAGCTGCAGAGCTGGAAAAGAAGTTGGACTCA
GAGTTAACAGCCCGACATGAGCTACAGGTGGAAATGAAAAAGATGGAAAGTGACTTTGAGCAGAAGCTTC
AAGATCTTCAGGGAGAAAAAGATGCACTGCATTCTGAAAAGCAGCAAATTGCCACAGAGAAACAGGACCT
GGAAGCAGAGGTGTCCCAGCTCACAGGAGAGGTTGCCAAGCTGACAAAGGAACTGGAAGATGCCAAGAAA
GAAATGGCTTCCCTCTCTGCGGCAGCTATTACTGTACCTCCTTCTGTTCCTAGTCGTGCTCCTGTTCCCC
CTGCCCCTCCTTTACCTGGTGACTCTGGCACTATTATTCCACCACCACCTGCTCCTGGGGATAGTACCAC
TCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCACCTCCTTTGCCTGGGGGTGTTTGCATCTCCTCACCC
CCTTCTTTACCTGGAGGTACTGCTATCTCTCCACCCCCTCCTTTGTCTGGGGATGCTACCATCCCTCCAC
CCCCTCCTTTGCCTGAGGGTGTTGGCATCCCTTCACCCTCTTCTTTGCCTGGAGGTACTGCCATCCCCCC
ACCTCCTCCTTTGCCTGGGAGTGCTAGAATCCCCCCACCACCACCTCCTTTGCCTGGGAGTGCTGGAATT
CCCCCCCCACCTCCTCCCTTGCCTGGAGAAGCAGGAATGCCACCTCCTCCTCCCCCTCTTCCTGGTGGTC
CTGGAATCCCTCCACCTCCTCCATTTCCCGGAGGCCCTGGCATTCCTCCACCTCCACCCGGAATGGGTAT
GCCTCCACCTCCCCCATTTGGATTTGGAGTTCCTGCAGCCCCAGTTCTGCCATTTGGATTAACCCCCAAA
AAGCTTTATAAGCCAGAGGTGCAGCTCCGGAGGCCAAACTGGTCCAAGCTTGTGGCTGAGGACCTCTCCC
AGGACTGCTTCTGGACAAAGGTGAAGGAGGACCGCTTTGAGAACAATGAACTTTTCGCCAAACTTACCCT
TACCTTCTCTGCCCAGACCAAGACTTCCAAAGCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCT
GTGCAAAAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCCCAGAATCTCTCAATCTTTT
TGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGAC
TGAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTG
AAGGATGAATATGATGACCTGGCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGC
GGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGCGAGCAAGTGGAGAATATCAAGCCAGAGAT
TGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTAGAGATTACC
TTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAATATCAGCTTCC
TCTGTAAGCTTCGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTG
TGAGAATGACTATCCCGATGTCCTCAAGTTTCCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTT
TCTGCTGAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCTGATGTGGAACGTGATGTTC
AGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATGACCAGCTTTGTGAAGGATGC
ACAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAG
TACTTCCTCTTTGACCCCAAGAAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATA
TGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAGACAGAAGAAAAGATGAGGCGAGCAAAACT
AGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATAGACATGAAT
GCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGAC
GGAAGAGAGGGCCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCT
GACCAAGGATGATGCCATGGCTGCTGTTCCTGCCAAGGTGTCCAAGAACAGTGAGACATTCCCCACAATC
CTTGAGGAAGCCAAGGAGTTGGTTGGCCGTGCAAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC216318 representing NM_005219
Red=Cloning site Green=Tags(s)

MEPPGGSLGPGRGTRDKKKGRSPDELPSAGGDGGKSKKFTLKRLMADELERFTSMRIKKEKEKPNSAHRN
SSASYGDDPTAQSLQDVSDEQVLVLFEQMLLDMNLNEEKQQPLREKDIIIKREMVSQYLYTSKAGMSQKE
SSKSAMMYIQELRSGLRDMPLLSCLESLRVSLNNNPVSWVQTFGAEGLASLLDILKRLHDEKEETAGSYD
SRNKHEIIRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVL
EAMTERAEMDEVERFQPLLDGLKSGTTIALKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQDL
REIENEDMRVQLNVFDEQGEEDSYDLKGRLDDIRMEMDDFNEVFQILLNTVKDSKAEPHFLSILQHLLLV
RNDYEARPQYYKLIEECISQIVLHKNGADPDFKCRHLQIEIEGLIDQMIDKTKVEKSEAKAAELEKKLDS
ELTARHELQVEMKKMESDFEQKLQDLQGEKDALHSEKQQIATEKQDLEAEVSQLTGEVAKLTKELEDAKK
EMASLSAAAITVPPSVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPPPPLPGGVCISSP
PSLPGGTAISPPPPLSGDATIPPPPPLPEGVGIPSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGI
PPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAPVLPFGLTPK
KLYKPEVQLRRPNWSKLVAEDLSQDCFWTKVKEDRFENNELFAKLTLTFSAQTKTSKAKKDQEGGEEKKS
VQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSEL
KDEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLLEIT
LLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKASRV
SAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGE
YFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMN
AEGDETGVMDSLLEALQSGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVPAKVSKNSETFPTI
LEEAKELVGRAS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005219
ORF Size 3816 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005219.3, NM_005219.4, NP_005210
RefSeq Size 5745
RefSeq ORF 3819
Locus ID 1729
Cytogenetics 5q31.3
Domains FH2
Protein Families Stem cell - Pluripotency, Druggable Genome
Protein Pathways Focal adhesion, Regulation of actin cytoskeleton
MW 141.2 kDa
Gene Summary This gene is a homolog of the Drosophila diaphanous gene, and has been linked to autosomal dominant, fully penetrant, nonsyndromic sensorineural progressive low-frequency hearing loss. Actin polymerization involves proteins known to interact with diaphanous protein in Drosophila and mouse. It has therefore been speculated that this gene may have a role in the regulation of actin polymerization in hair cells of the inner ear. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)