CYP26A1 (NM_000783) Human Tagged ORF Clone

CAT#: RC216278

CYP26A1 (Myc-DDK-tagged)-Human cytochrome P450, family 26, subfamily A, polypeptide 1 (CYP26A1), transcript variant 1

Change vector?

USD 639


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CYP26A1 (NM_000783) Human Tagged ORF Clone
Symbol CYP26A1
Synonyms CP26; CYP26; P450RAI; P450RAI1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC216278 representing NM_000783
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCTCCCGGCGCTGCTGGCCAGTGCGCTCTGCACCTTCGTGCTGCCGCTGCTGCTCTTCCTGGCTG
CGATCAAGCTCTGGGACCTGTACTGCGTGAGCGGCCGCGACCGCAGTTGTGCCCTCCCATTGCCCCCCGG
GACTATGGGCTTCCCCTTCTTTGGGGAAACCTTGCAGATGGTACTGCAGCGGAGGAAGTTCCTGCAGATG
AAGCGCAGGAAATACGGCTTCATCTACAAGACGCATCTGTTCGGGCGGCCCACCGTACGGGTGATGGGCG
CGGACAATGTGCGGCGCATCTTGCTCGGAGAGCACCGGCTGGTGTCGGTCCACTGGCCAGCGTCGGTGCG
CACCATTCTGGGATCTGGCTGCCTCTCTAACCTGCACGACTCCTCGCACAAGCAGCGCAAGAAGGTGATT
ATGCGGGCCTTCAGCCGCGAGGCACTCGAATGCTACGTGCCGGTGATCACCGAGGAAGTGGGCAGCAGCC
TGGAGCAGTGGCTGAGCTGCGGCGAGCGCGGCCTCCTGGTCTACCCCGAGGTGAAGCGCCTCATGTTCCG
AATCGCCATGCGCATCCTACTGGGCTGCGAACCCCAACTGGCGGGCGACGGGGACTCCGAGCAGCAGCTT
GTGGAGGCCTTCGAGGAAATGACCCGCAATCTCTTCTCGCTGCCCATCGACGTGCCCTTCAGCGGGCTGT
ACCGGGGCATGAAGGCGCGGAACCTCATTCACGCGCGCATCGAGCAGAACATTCGCGCCAAGATCTGCGG
GCTGCGGGCATCCGAGGCGGGCCAGGGCTGCAAAGACGCGCTGCAGCTGTTGATCGAGCACTCGTGGGAG
AGGGGAGAGCGGCTGGACATGCAGGCACTAAAGCAATCTTCAACCGAACTCCTCTTTGGAGGACACGAAA
CCACGGCCAGTGCAGCCACATCTCTGATCACTTACCTGGGGCTCTACCCACATGTTCTCCAGAAAGTGCG
AGAAGAGCTGAAGAGTAAGGGTTTACTTTGCAAGAGCAATCAAGACAACAAGTTGGACATGGAAATTTTG
GAACAACTTAAATACATCGGGTGTGTTATTAAGGAGACCCTTCGACTGAATCCCCCAGTTCCAGGAGGGT
TTCGGGTTGCTCTGAAGACTTTTGAATTAAATGGATACCAGATTCCCAAGGGCTGGAATGTTATCTACAG
TATCTGTGATACTCATGATGTGGCAGAGATCTTCACCAACAAGGAAGAATTTAATCCTGACCGATTCATG
CTGCCTCACCCAGAGGATGCATCCAGGTTCAGCTTCATTCCATTTGGAGGAGGCCTTAGGAGCTGTGTAG
GCAAAGAATTTGCAAAAATTCTTCTCAAAATATTTACAGTGGAGCTGGCCAGGCATTGTGACTGGCAGCT
TCTAAATGGACCTCCTACAATGAAAACCAGTCCCACCGTGTATCCTGTGGACAATCTCCCTGCAAGATTC
ACCCATTTCCATGGGGAAATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC216278 representing NM_000783
Red=Cloning site Green=Tags(s)

MGLPALLASALCTFVLPLLLFLAAIKLWDLYCVSGRDRSCALPLPPGTMGFPFFGETLQMVLQRRKFLQM
KRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTILGSGCLSNLHDSSHKQRKKVI
MRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPEVKRLMFRIAMRILLGCEPQLAGDGDSEQQL
VEAFEEMTRNLFSLPIDVPFSGLYRGMKARNLIHARIEQNIRAKICGLRASEAGQGCKDALQLLIEHSWE
RGERLDMQALKQSSTELLFGGHETTASAATSLITYLGLYPHVLQKVREELKSKGLLCKSNQDNKLDMEIL
EQLKYIGCVIKETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFM
LPHPEDASRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLLNGPPTMKTSPTVYPVDNLPARF
THFHGEI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000783
ORF Size 1491 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000783.1, NM_000783.2, NM_000783.3, NP_000774
RefSeq Size 2099
RefSeq ORF 1494
Locus ID 1592
Cytogenetics 10q23.33
Domains p450
Protein Families Transmembrane, P450, Druggable Genome
Protein Pathways Retinol metabolism
MW 56 kDa
Gene Summary This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein acts on retinoids, including all-trans-retinoic acid (RA), with both 4-hydroxylation and 18-hydroxylation activities. This enzyme regulates the cellular level of retinoic acid which is involved in regulation of gene expression in both embryonic and adult tissues. Two alternatively spliced transcript variants of this gene, which encode the distinct isoforms, have been reported. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations