WSTF(BAZ1B) (NM_032408) Human Tagged ORF Clone

CAT#: RC216159

BAZ1B (Myc-DDK-tagged)-Human bromodomain adjacent to zinc finger domain, 1B (BAZ1B)

Change vector?

  • TrueORF®

USD 824


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name WSTF(BAZ1B) (NM_032408) Human Tagged ORF Clone
Symbol BAZ1B
Synonyms WBSCR10; WBSCR9; WSTF
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC216159 representing NM_032408
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCCGCTCCTGGGCCGCAAGCCCTTCCCGCTGGTGAAGCCGTTGCCCGGAGAGGAGCCGCTCTTCA
CCATCCCGCACACTCAGGAGGCCTTCCGCACCCGGGAAGAGTATGAAGCCCGCTTGGAAAGGTACAGTGA
GCGCATTTGGACGTGCAAGAGTACTGGAAGCAGTCAGCTAACACACAAGGAAGCCTGGGAGGAAGAACAG
GAAGTTGCTGAGCTTTTGAAGGAGGAGTTTCCTGCCTGGTATGAGAAGCTTGTTCTGGAAATGGTTCACC
ATAACACAGCCTCCTTAGAGAAGTTAGTAGATACTGCTTGGTTGGAGATCATGACCAAATATGCTGTGGG
AGAAGAGTGTGACTTCGAGGTTGGGAAGGAGAAAATGCTCAAGGTGAAGATTGTGAAGATTCATCCTTTG
GAGAAAGTGGATGAAGAGGCCACTGAGAAGAAATCTGATGGTGCCTGTGATTCTCCATCAAGTGACAAAG
AGAACTCCAGTCAGATTGCTCAGGACCATCAGAAGAAGGAGACAGTTGTGAAAGAGGATGAAGGAAGGAG
AGAGAGTATTAATGACAGAGCACGTAGATCGCCACGAAAACTTCCTACTTCATTAAAAAAAGGAGAAAGG
AAATGGGCTCCTCCAAAATTTCTGCCTCACAAATATGATGTGAAACTACAAAATGAAGATAAGATCATCA
GTAACGTGCCAGCAGACAGCTTGATTCGTACAGAGCGCCCACCAAATAAGGAGATAGTTCGATACTTTAT
ACGGCATAATGCATTACGAGCTGGTACTGGTGAAAATGCACCTTGGGTCGTAGAAGATGAATTGGTGAAG
AAATACTCTCTGCCCAGCAAGTTCAGTGACTTTTTACTTGATCCATACAAGTATATGACTCTCAACCCTT
CTACTAAGAGGAAGAATACTGGATCCCCAGACAGGAAGCCCTCAAAGAAATCCAAGACAGACAACTCTTC
TCTTAGTTCACCACTAAATCCTAAGTTATGGTGTCACGTACACTTGAAGAAGTCATTGAGTGGCTCGCCA
CTCAAAGTGAAGAACTCAAAGAATTCCAAATCTCCTGAAGAACATCTAGAAGAAATGATGAAGATGATGT
CGCCCAATAAGCTGCACACTAACTTTCACATTCCTAAAAAAGGCCCACCTGCCAAGAAACCAGGGAAGCA
CAGTGACAAGCCTTTGAAGGCAAAGGGCAGAAGCAAAGGCATCCTGAATGGACAGAAATCCACAGGGAAT
TCCAAATCTCCCAAAAAAGGACTGAAGACTCCTAAAACCAAAATGAAGCAGATGACTTTGTTGGATATGG
CCAAAGGCACGCAGAAGATGACACGAGCCCCACGGAATTCTGGGGGTACACCTAGGACCTCTAGTAAACC
TCATAAACATCTGCCTCCTGCAGCCCTACACCTCATTGCATACTACAAAGAAAACAAAGACAGGGAGGAC
AAGAGGAGCGCCCTGTCCTGTGTTATCTCCAAAACAGCTCGTCTTCTCTCTAGTGAAGATAGAGCTCGTC
TCCCAGAAGAATTGCGAAGTCTTGTTCAAAAACGCTATGAACTTCTAGAGCACAAAAAGAGGTGGGCTTC
TATGTCTGAAGAACAACGGAAAGAATATTTGAAAAAGAAACGGGAGGAGCTGAAAAAGAAGTTGAAGGAA
AAAGCCAAAGAACGAAGAGAGAAAGAAATGCTTGAGAGATTAGAAAAACAGAAGCGGTATGAGGACCAAG
AGTTAACTGGCAAAAACCTTCCAGCATTCAGATTGGTGGATACCCCTGAAGGGCTGCCCAACACGCTGTT
TGGGGATGTGGCCATGGTGGTGGAATTCTTGAGCTGTTATTCTGGGCTACTTTTACCAGATGCTCAGTAT
CCTATTACTGCTGTGTCCCTTATGGAAGCCTTGAGTGCAGATAAGGGTGGCTTTTTATACCTTAACAGGG
TGTTGGTCATCCTCTTACAGACCCTCCTACAAGATGAGATAGCAGAAGACTATGGTGAATTGGGAATGAA
GCTGTCGGAAATCCCCTTGACTCTGCATTCTGTTTCAGAGCTGGTGCGGCTCTGCTTGCGCAGATCTGAT
GTTCAGGAGGAAAGCGAGGGCTCAGACACAGATGACAATAAAGATTCAGCTGCATTTGAGGATAATGAGG
TACAAGATGAGTTCCTAGAAAAGCTGGAGACCTCTGAATTTTTTGAGCTGACGTCAGAGGAGAAGCTACA
GATCTTGACAGCACTGTGCCACCGGATCCTCATGACATACTCAGTGCAAGACCACATGGAGACCAGACAG
CAGATGTCTGCAGAGTTGTGGAAGGAACGGCTTGCTGTGTTGAAGGAAGAAAATGATAAGAAGAGAGCAG
AGAAACAGAAACGGAAAGAAATGGAAGCCAAAAATAAAGAAAATGGAAAAGTTGAGAATGGGTTAGGCAA
AACTGATAGGAAAAAAGAAATTGTGAAGTTTGAGCCCCAAGTAGATACAGAAGCTGAAGACATGATTAGT
GCTGTGAAGAGCAGAAGGTTGCTTGCCATTCAAGCTAAGAAGGAACGGGAAATCCAGGAAAGAGAAATGA
AAGTGAAACTGGAACGCCAAGCTGAAGAAGAACGAATACGGAAGCACAAAGCAGCTGCTGAGAAAGCTTT
CCAGGAAGGGATTGCCAAGGCCAAACTAGTCATGCGCAGGACTCCTATTGGCACAGATCGAAACCATAAT
AGATACTGGCTCTTCTCAGATGAAGTTCCAGGATTATTCATTGAAAAAGGCTGGGTACATGACAGCATTG
ACTACCGATTCAACCATCACTGCAAAGACCACACAGTCTCTGGTGATGAGGATTACTGTCCTCGCAGTAA
GAAAGCAAACTTAGGTAAAAATGCAAGCATGAACACACAACATGGAACAGCAACAGAAGTTGCTGTAGAG
ACAACCACACCCAAACAAGGACAGAACCTATGGTTTTTATGTGATAGTCAAAAGGAGCTGGATGAGTTGC
TAAACTGTCTTCACCCTCAGGGAATAAGAGAAAGTCAACTTAAAGAGAGACTAGAGAAGAGGTACCAGGA
CATTATTCACTCTATTCATCTAGCACGGAAGCCAAATTTGGGTCTAAAATCTTGTGATGGCAACCAGGAG
CTTTTAAACTTCCTTCGTAGTGATCTCATTGAAGTTGCAACAAGGTTACAAAAAGGAGGACTTGGATATG
TGGAAGAAACATCAGAATTTGAAGCCCGGGTCATTTCATTAGAGAAATTGAAGGATTTTGGTGAGTGTGT
GATTGCCCTTCAGGCCAGTGTCATAAAGAAATTTCTCCAAGGCTTCATGGCTCCCAAGCAAAAGAGAAGA
AAACTCCAAAGTGAAGATTCAGCAAAAACTGAGGAAGTGGATGAAGAGAAGAAAATGGTAGAGGAAGCAA
AGGTTGCATCTGCACTGGAGAAATGGAAGACAGCAATCCGGGAAGCTCAGACTTTCTCCAGGATGCACGT
GCTGCTTGGGATGCTTGATGCCTGTATCAAGTGGGATATGTCCGCAGAAAATGCTAGGTGCAAAGTTTGT
CGAAAGAAAGGTGAGGATGACAAATTGATCTTATGTGATGAGTGTAATAAAGCCTTCCACCTGTTTTGTC
TGAGGCCGGCCCTCTATGAAGTACCAGATGGTGAGTGGCAGTGCCCAGCTTGCCAGCCCGCTACTGCCAG
GCGCAACTCCCGTGGCAGGAACTATACTGAAGAGTCTGCTTCTGAGGACAGTGAAGATGATGAGAGTGAT
GAAGAGGAGGAGGAGGAAGAAGAGGAGGAGGAGGAAGAAGATTATGAGGTGGCTGGTTTGCGATTGAGAC
CTCGAAAGACCATCCGGGGCAAGCACAGCGTCATCCCCCCTGCAGCAAGGTCAGGCCGGCGCCCGGGTAA
GAAGCCACACTCTACCAGGAGGTCTCAGCCCAAGGCACCACCTGTGGATGATGCTGAGGTGGATGAGCTG
GTGCTTCAGACCAAGCGGAGCTCCCGGAGGCAAAGCCTGGAGCTGCAGAAGTGTGAAGAGATCCTCCACA
AGATCGTGAAGTACCGCTTCAGCTGGCCCTTCAGGGAGCCTGTGACCAGAGATGAGGCCGAGGACTACTA
TGATGTGATCACGCACCCCATGGACTTTCAGACAGTGCAGAACAAATGTTCCTGTGGGAGCTACCGCTCT
GTGCAGGAGTTTCTTACTGACATGAAGCAAGTGTTTACCAATGCTGAGGTTTACAACTGCCGTGGCAGCC
ATGTGCTAAGCTGCATGGTGAAGACAGAACAGTGTCTAGTGGCTCTGTTGCATAAACACCTTCCTGGCCA
CCCATATGTCCGCAGGAAGCGCAAGAAGTTTCCTGATAGGCTTGCTGAAGATGAAGGGGACAGTGAGCCA
GAGGCCGTTGGACAGTCCAGGGGACGAAGACAGAAGAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC216159 representing NM_032408
Red=Cloning site Green=Tags(s)

MAPLLGRKPFPLVKPLPGEEPLFTIPHTQEAFRTREEYEARLERYSERIWTCKSTGSSQLTHKEAWEEEQ
EVAELLKEEFPAWYEKLVLEMVHHNTASLEKLVDTAWLEIMTKYAVGEECDFEVGKEKMLKVKIVKIHPL
EKVDEEATEKKSDGACDSPSSDKENSSQIAQDHQKKETVVKEDEGRRESINDRARRSPRKLPTSLKKGER
KWAPPKFLPHKYDVKLQNEDKIISNVPADSLIRTERPPNKEIVRYFIRHNALRAGTGENAPWVVEDELVK
KYSLPSKFSDFLLDPYKYMTLNPSTKRKNTGSPDRKPSKKSKTDNSSLSSPLNPKLWCHVHLKKSLSGSP
LKVKNSKNSKSPEEHLEEMMKMMSPNKLHTNFHIPKKGPPAKKPGKHSDKPLKAKGRSKGILNGQKSTGN
SKSPKKGLKTPKTKMKQMTLLDMAKGTQKMTRAPRNSGGTPRTSSKPHKHLPPAALHLIAYYKENKDRED
KRSALSCVISKTARLLSSEDRARLPEELRSLVQKRYELLEHKKRWASMSEEQRKEYLKKKREELKKKLKE
KAKERREKEMLERLEKQKRYEDQELTGKNLPAFRLVDTPEGLPNTLFGDVAMVVEFLSCYSGLLLPDAQY
PITAVSLMEALSADKGGFLYLNRVLVILLQTLLQDEIAEDYGELGMKLSEIPLTLHSVSELVRLCLRRSD
VQEESEGSDTDDNKDSAAFEDNEVQDEFLEKLETSEFFELTSEEKLQILTALCHRILMTYSVQDHMETRQ
QMSAELWKERLAVLKEENDKKRAEKQKRKEMEAKNKENGKVENGLGKTDRKKEIVKFEPQVDTEAEDMIS
AVKSRRLLAIQAKKEREIQEREMKVKLERQAEEERIRKHKAAAEKAFQEGIAKAKLVMRRTPIGTDRNHN
RYWLFSDEVPGLFIEKGWVHDSIDYRFNHHCKDHTVSGDEDYCPRSKKANLGKNASMNTQHGTATEVAVE
TTTPKQGQNLWFLCDSQKELDELLNCLHPQGIRESQLKERLEKRYQDIIHSIHLARKPNLGLKSCDGNQE
LLNFLRSDLIEVATRLQKGGLGYVEETSEFEARVISLEKLKDFGECVIALQASVIKKFLQGFMAPKQKRR
KLQSEDSAKTEEVDEEKKMVEEAKVASALEKWKTAIREAQTFSRMHVLLGMLDACIKWDMSAENARCKVC
RKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPATARRNSRGRNYTEESASEDSEDDESD
EEEEEEEEEEEEEDYEVAGLRLRPRKTIRGKHSVIPPAARSGRRPGKKPHSTRRSQPKAPPVDDAEVDEL
VLQTKRSSRRQSLELQKCEEILHKIVKYRFSWPFREPVTRDEAEDYYDVITHPMDFQTVQNKCSCGSYRS
VQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEP
EAVGQSRGRRQKK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_032408
ORF Size 4449 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_032408.1, NM_032408.2, NM_032408.3, NP_115784
RefSeq Size 6043
RefSeq ORF 4452
Locus ID 9031
Cytogenetics 7q11.23
Domains BROMO, PHD, DDT
Protein Families Transcription Factors, Druggable Genome
MW 170.7 kDa
Gene Summary This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations